Panthera uncia (snow leopard): 125936704 Help Entry 125936704         CDS       T08832                                  Name (RefSeq) bcl-2-like protein 1 isoform X1   KO K04570   Bcl-2-like 1 (apoptosis regulator Bcl-X) Organism puc  Panthera uncia (snow leopard) Pathway puc01521   EGFR tyrosine kinase inhibitor resistance puc01524   Platinum drug resistance puc04014   Ras signaling pathway puc04064   NF-kappa B signaling pathway puc04115   p53 signaling pathway puc04137   Mitophagy - animal puc04140   Autophagy - animal puc04151   PI3K-Akt signaling pathway puc04210   Apoptosis puc04215   Apoptosis - multiple species puc04621   NOD-like receptor signaling pathway puc04630   JAK-STAT signaling pathway puc05012   Parkinson disease puc05014   Amyotrophic lateral sclerosis puc05022   Pathways of neurodegeneration - multiple diseases puc05145   Toxoplasmosis puc05162   Measles puc05166   Human T-cell leukemia virus 1 infection puc05168   Herpes simplex virus 1 infection puc05170   Human immunodeficiency virus 1 infection puc05200   Pathways in cancer puc05202   Transcriptional misregulation in cancer puc05212   Pancreatic cancer puc05220   Chronic myeloid leukemia puc05222   Small cell lung cancer puc05225   Hepatocellular carcinoma puc05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:puc00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     125936704    04630 JAK-STAT signaling pathway     125936704    04064 NF-kappa B signaling pathway     125936704    04151 PI3K-Akt signaling pathway     125936704  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     125936704    04137 Mitophagy - animal     125936704   09143 Cell growth and death    04210 Apoptosis     125936704    04215 Apoptosis - multiple species     125936704    04115 p53 signaling pathway     125936704  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     125936704  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     125936704    05202 Transcriptional misregulation in cancer     125936704   09162 Cancer: specific types    05212 Pancreatic cancer     125936704    05225 Hepatocellular carcinoma     125936704    05220 Chronic myeloid leukemia     125936704    05222 Small cell lung cancer     125936704   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     125936704    05170 Human immunodeficiency virus 1 infection     125936704    05162 Measles     125936704    05168 Herpes simplex virus 1 infection     125936704   09174 Infectious disease: parasitic    05145 Toxoplasmosis     125936704   09164 Neurodegenerative disease    05012 Parkinson disease     125936704    05014 Amyotrophic lateral sclerosis     125936704    05022 Pathways of neurodegeneration - multiple diseases     125936704   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     125936704   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     125936704    01524 Platinum drug resistance     125936704  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:puc01009]     125936704   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:puc03036]     125936704   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:puc02000]     125936704 Protein phosphatases and associated proteins [BR:puc01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      125936704 Chromosome and associated proteins [BR:puc03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     125936704 Transporters [BR:puc02000]  Other transporters   Pores ion channels [TC:1]    125936704 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 Motif Other DBs NCBI-GeneID:  125936704 NCBI-ProteinID:  XP_049506919 LinkDB All DBs Position A3 Genome browser AA seq 233 aa AA seqDB search MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLA DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIATWMATYLNDHLEP WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK NT seq 702 nt NT seq  +upstreamnt  +downstreamnt atgtctcagagcaaccgggagctggtggttgactttctctcctacaagctttcccagaaa ggatacagctggagtcagtttagtgatgtggaagagaacagaactgaggccccagaaggg actgaatcggagatggagacccccagtgccatcaatggcaacccatcctggcacttggcg gacagccctgcggtgaatggagccactggccacagcagcagcttggatgcccgggaggtg atccccatggcagcggtgaagcaggcgctgagggaggccggggatgagtttgaactgagg taccgacgggcattcagcgacctgacatcccagcttcacatcaccccagggacagcatat cagagctttgagcaggtagtgaacgaactcttccgggatggggtgaactggggtcgcatt gtggcctttttctccttcggtggggcactgtgcgtggaaagcgtagacaaggagatgcag gtattggtgagtcggatcgcaacttggatggccacttacctgaacgaccacctagagcct tggatccaggagaacggcggctgggacacttttgtggaactctacgggaacaatgcagcg gccgagagccggaagggccaggagcgcttcaaccgctggttcctgacaggcatgactgtg gctggcgtggttctgctgggctcactcttcagtcggaaatga

DBGET integrated database retrieval system