Panthera uncia (snow leopard): 125939004 Help Entry 125939004         CDS       T08832                                  Name (RefSeq) dynein light chain Tctex-type 1   KO K10420   dynein light chain Tctex-type 1/3 Organism puc  Panthera uncia (snow leopard) Pathway puc04814   Motor proteins puc05132   Salmonella infection Brite KEGG Orthology (KO) [BR:puc00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     125939004  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     125939004  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:puc03037]     125939004    04812 Cytoskeleton proteins [BR:puc04812]     125939004 Cilium and associated proteins [BR:puc03037]  Motile cilia and associated proteins   Dynein arm    125939004 Cytoskeleton proteins [BR:puc04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      125939004 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tctex-1 P22_AR_C Motif Other DBs NCBI-GeneID:  125939004 NCBI-ProteinID:  XP_049510474 LinkDB All DBs Position B2 Genome browser AA seq 113 aa AA seqDB search MEDYQAADETAFVVDEVSNIVKEAIESAIGGNAYQHSKVNQWTTNVVEQTLSQLTKLGKP FKYIVTCVIMQKNGAGLHTASSCFWDSSTDGSCTVRWENKTMYCIVSAFGLSI NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggaagactaccaggctgccgacgagactgcttttgttgttgatgaagtgagcaacatt gtaaaagaggctatagaaagtgcaatcggtggcaacgcctatcagcacagcaaagtgaac cagtggaccacaaacgtagtcgaacagactttaagccaactcaccaagctgggcaagcca tttaaatacatcgtgacctgtgtaattatgcagaagaacggagcagggttacacacggca agttcctgcttctgggacagctctacggacggcagctgcactgtgcggtgggagaacaag accatgtactgcatcgtcagcgccttcgggctgtccatctga

DBGET integrated database retrieval system