Panthera uncia (snow leopard): 125939375 Help Entry 125939375         CDS       T08832                                  Name (RefSeq) histone H3.1   KO K11253   histone H3 Organism puc  Panthera uncia (snow leopard) Pathway puc04613   Neutrophil extracellular trap formation puc05034   Alcoholism puc05202   Transcriptional misregulation in cancer puc05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:puc00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     125939375  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     125939375   09163 Immune disease    05322 Systemic lupus erythematosus     125939375   09165 Substance dependence    05034 Alcoholism     125939375  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:puc03036]     125939375   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:puc04147]     125939375 Chromosome and associated proteins [BR:puc03036]  Eukaryotic type   Nucleosome assembly factors    Histones     125939375 Exosome [BR:puc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    125939375 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-S CENP-T_C CBFD_NFYB_HMF PAF YebU_pre-PUA_dom TFIID-31kDa Motif Other DBs NCBI-GeneID:  125939375 NCBI-ProteinID:  XP_049510771 LinkDB All DBs Position B2 Genome browser AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgtaccaagcagacagcgcgcaagtcgacgggcggcaaggccccgcgcaagcag ctggccaccaaggcggcccgcaagagcgcgccggccaccggcggcgtcaagaagccgcac cgctaccggcccggcacggtggccctgcgcgagatccgccgctaccagaagtccaccgag ctgctgatccgcaagctgccgttccagcggctggtgcgcgagatcgcgcaggacttcaag accgacctgcgcttccagagctcggccgtgatggcgctgcaggaggcgtgcgaggcctac ctggtggggctcttcgaggacaccaacctgtgcgccatccacgccaagcgcgtcaccatc atgcccaaggacatccagctggcgcgccgcatccgcggcgagagggcttaa

DBGET integrated database retrieval system