Panthera uncia (snow leopard): 125939401 Help Entry 125939401         CDS       T08832                                  Name (RefSeq) histone H4   KO K11254   histone H4 Organism puc  Panthera uncia (snow leopard) Pathway puc04613   Neutrophil extracellular trap formation puc05034   Alcoholism puc05203   Viral carcinogenesis puc05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:puc00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     125939401  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     125939401   09163 Immune disease    05322 Systemic lupus erythematosus     125939401   09165 Substance dependence    05034 Alcoholism     125939401  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:puc03036]     125939401 Chromosome and associated proteins [BR:puc03036]  Eukaryotic type   Nucleosome assembly factors    Histones     125939401 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  125939401 NCBI-ProteinID:  XP_049510802 LinkDB All DBs Position B2 Genome browser AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtcaggtcgcggcaaaggcgggaagggcctaggcaagggaggcgccaagcgccaccgc aaggtgctgcgcgacaacatccagggcatcaccaagcccgccatccggcggctggcccgg cgcggcggcgtcaagcgcatctccggcctcatctacgaggagacccgcggggtgctcaag gtgttcctggagaacgtgatccgggacgccgtcacctacacggagcacgccaagcgcaag acggtcacggccatggacgtggtgtacgcgctcaagcgccagggccgcaccctctacggc ttcgggggctaa

DBGET integrated database retrieval system