KEGG   Neopusillimonas aestuarii: G9Q38_05585
Entry
G9Q38_05585       CDS       T06486                                 
Symbol
phoB
Name
(GenBank) phosphate regulon transcriptional regulatory protein PhoB
  KO
K07657  two-component system, OmpR family, phosphate regulon response regulator PhoB
Organism
pud  Neopusillimonas aestuarii
Pathway
pud02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pud00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    G9Q38_05585 (phoB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:pud02022]
    G9Q38_05585 (phoB)
Two-component system [BR:pud02022]
 OmpR family
  PhoR-PhoB (phosphate starvation response)
   G9Q38_05585 (phoB)
SSDB
Motif
Pfam: Response_reg Trans_reg_C DUF7669
Other DBs
NCBI-ProteinID: QIM48681
LinkDB
Position
complement(1149784..1150488)
AA seq 234 aa
MNTTILVVEDEPAIQELIAVNLSFAGHKVLRAFDAEQAQTLIRAELPDLILLDWMLPGAS
GITLAKQLRSDERTRQVPVIMLTAKGAENDKIEGLEAGADDYITKPFSPKELMARIKAVL
RRRAPQLTDDIIQIGTLVLDPSTHRVSGNGTALSIGPTEFRLLHFFMTHTERVFSRSQLL
DQVWGDHVFVEERTVDVHIRRLRKALEPSGHENHIETVRGAGYRFAARLPSATP
NT seq 705 nt   +upstreamnt  +downstreamnt
atgaacaccactattctcgtcgttgaagatgaacccgcgattcaggagctaatcgctgta
aacctgtcatttgccggtcacaaggtactgcgcgcattcgatgcggaacaagcacaaacg
ctcatccgtgccgaactacccgatttgattttgctcgattggatgctgcccggcgcctca
ggcatcactctggcaaaacaactgagatccgacgaaagaacgcgccaagtccccgtgatt
atgctcactgcgaaaggggcggagaacgataaaatagaaggcctggaggccggcgccgac
gactacatcaccaagcccttctcacccaaagagctcatggcgcgcatcaaagccgtgttg
cgtcgccgcgctccccagctcaccgatgacattatccaaatcggcacactggttctcgac
ccctccacccaccgggtcagcggaaacggcaccgctctatcgattggccccactgagttt
cgcttgctacactttttcatgacgcacacggaacgcgttttttcccgttcacaattgctc
gatcaggtatggggtgatcacgtctttgtcgaagagcgcaccgtcgacgttcatattcgt
cggctacgtaaagcgctcgagcccagcggtcacgaaaaccatattgaaaccgtacgcggc
gcgggctatcgatttgccgcccgtttacccagtgcaacgccttaa

DBGET integrated database retrieval system