Neopusillimonas aestuarii: G9Q38_08070 Help Entry G9Q38_08070       CDS       T06486                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pud  Neopusillimonas aestuarii Pathway pud01100   Metabolic pathways pud01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pud00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     G9Q38_08070 (acpP)    00074 Mycolic acid biosynthesis     G9Q38_08070 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     G9Q38_08070 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C PP-binding_2 Ribosomal_L50 DUF1896 HLH EutQ Motif Other DBs NCBI-ProteinID:  QIM49141 LinkDB All DBs Position 1658357..1658596 Genome browser AA seq 79 aa AA seqDB search MESIEQRVKKIVAEQLGVNEAEIKNESSFLDDLGADSLDMVELVMALEDEFETEIPDEEA EKITTVQQAVEYINSHSKE NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggaaagcatcgaacagcgcgtcaagaagatcgtcgctgaacaacttggcgttaacgaa gccgagatcaaaaacgaatcttccttccttgacgacctcggtgccgattcgctcgatatg gtcgagctcgtaatggcactcgaagacgaattcgaaactgaaatccctgacgaggaagca gagaaaattacgaccgttcaacaagccgtcgagtacatcaactcgcacagcaaagaataa

DBGET integrated database retrieval system