Pusillimonas sp. DMV24BSW_D: G9Q38_08070 Help Entry G9Q38_08070       CDS       T06486                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pud  Pusillimonas sp. DMV24BSW_D Pathway pud01100   Metabolic pathways pud01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pud00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     G9Q38_08070 (acpP)    00074 Mycolic acid biosynthesis     G9Q38_08070 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     G9Q38_08070 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 DUF1896 Ribosomal_L50 HLH EutQ Motif Other DBs NCBI-ProteinID:  QIM49141 UniProt:  A0A6G8I7W7 LinkDB All DBs Position 1658357..1658596 Genome browser AA seq 79 aa AA seqDB search MESIEQRVKKIVAEQLGVNEAEIKNESSFLDDLGADSLDMVELVMALEDEFETEIPDEEA EKITTVQQAVEYINSHSKE NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggaaagcatcgaacagcgcgtcaagaagatcgtcgctgaacaacttggcgttaacgaa gccgagatcaaaaacgaatcttccttccttgacgacctcggtgccgattcgctcgatatg gtcgagctcgtaatggcactcgaagacgaattcgaaactgaaatccctgacgaggaagca gagaaaattacgaccgttcaacaagccgtcgagtacatcaactcgcacagcaaagaataa

DBGET integrated database retrieval system