Paenibacillus urinalis: PUW25_01745
Help
Entry
PUW25_01745 CDS
T08959
Name
(GenBank) ABC transporter ATP-binding protein
KO
K24989
putative thiamine transport system ATP-binding protein
Organism
pui
Paenibacillus urinalis
Brite
KEGG Orthology (KO) [BR:
pui00001
]
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
pui02000
]
PUW25_01745
Transporters [BR:
pui02000
]
ABC transporters, prokaryotic type
Mineral and organic ion transporters
Putative thiamine transporter
PUW25_01745
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
ABC_tran
AAA_21
nSTAND1
SMC_N
AAA_16
AAA_29
AAA_23
AAA_22
RsgA_GTPase
ABC_ATPase
Motif
Other DBs
NCBI-ProteinID:
WDI02738
UniProt:
A0AAX3N044
LinkDB
All DBs
Position
complement(362585..363406)
Genome browser
AA seq
273 aa
AA seq
DB search
MHPLLEVSDIRLSFRQKKQQLHVLDHISLTVGQGEFVSIIGPSGSGKSSLFQIIGGLIQP
DAGTIRLDGEVVTGTRGNISYMPQQPALLPWRTIADNIKLGSEVAPAKFRSRQGADDARS
TQQWMAKAGLSGFEDMYPHKLSGGMQQRAAFLRALLSPQELMLLDEPFSALDALTRSEMQ
EWLLGIWEQSKRSVLFITHNIEEALLLSDRIYVFSNRPATVLHEVKVPFVRPRQEVLTED
PQFLRLKREISEWMREERRKQPVNAGSYPPNTK
NT seq
822 nt
NT seq
+upstream
nt +downstream
nt
atgcatcctttattagaagtgtcagacatccgcttatcatttcgtcagaaaaagcagcag
cttcatgtccttgatcacatatcacttacggttggccagggtgaattcgtctcgattatc
ggaccctcgggcagcggaaagagctctttatttcaaatcattggcggacttattcagcct
gatgcaggaacaatccgcttggacggagaagtggtaacaggaactcgtggcaatatcagc
tatatgccacagcagccagccctgctcccatggcggacaatcgcggataacatcaagctc
ggcagcgaggttgctcctgctaagttccgcagcaggcaaggagcagatgatgcacgatcc
acgcagcaatggatggctaaggctggtctgagcggctttgaagatatgtatccacacaag
ctgtcaggcggaatgcagcagcgggctgcctttttgcgcgcactcttaagtccacaggag
cttatgctgctcgatgagccgttcagtgcgctcgatgcactgacgagaagcgagatgcag
gagtggctgctcgggatatgggagcaatcgaagcgttcggtgctattcattacgcataat
attgaagaagcgcttctgctgtcagatcggatctatgtattttcgaatcgcccggccacc
gtactccatgaggtgaaggtcccatttgtccgaccaagacaggaagtgctgacagaggac
cctcaatttctccgcttgaagcgtgaaatatccgaatggatgcgggaggaaagacgtaaa
cagccggtgaatgccggctcttatccgccgaacacgaagtaa
DBGET
integrated database retrieval system