Pseudomonas umsongensis: HGP31_06035 Help Entry HGP31_06035       CDS       T06842                                  Symbol ftsB Name (GenBank) cell division protein FtsB   KO K05589   cell division protein FtsB Organism pum  Pseudomonas umsongensis Brite KEGG Orthology (KO) [BR:pum00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pum03036]     HGP31_06035 (ftsB) Chromosome and associated proteins [BR:pum03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     HGP31_06035 (ftsB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DivIC YabA Csm1_N ZapB XRCC4_CC Motif Other DBs NCBI-ProteinID:  QJC77879 UniProt:  A0AAE7DCW1 LinkDB All DBs Position 1360334..1360612 Genome browser AA seq 92 aa AA seqDB search MRSPNWLFLVLLLLLAGLQYRLWVGNGSLAQVAELTQQIADQQAENQTLLERNRVMDAEV SELKKGMETVEERARHELGMVKDGETLYQLAQ NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgcgcagtcccaattggttgtttctcgtcttgctcctgttgctggctggcctgcaatac cgcctgtgggtgggtaatggcagtctggcgcaagtggctgagctgacgcagcagattgcg gatcagcaggccgagaaccagacattgctggagcgtaatcgcgtgatggacgcggaagtc agtgagttgaaaaagggcatggagaccgttgaagagcgggctcgccatgagttgggcatg gtcaaggacggtgaaaccctttaccagttggcgcaatga

DBGET integrated database retrieval system