Pseudomonas umsongensis: HGP31_15505 Help Entry HGP31_15505       CDS       T06842                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pum  Pseudomonas umsongensis Pathway pum01100   Metabolic pathways pum01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pum00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HGP31_15505    00074 Mycolic acid biosynthesis     HGP31_15505   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HGP31_15505 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QJC79652 UniProt:  A0AAE6ZUK4 LinkDB All DBs Position complement(3427195..3427470) Genome browser AA seq 91 aa AA seqDB search MNSQVVRNEVLRALKGIAPEVEVEQLHTDRLLREEVDLDSMDWLRFIEALNRSLGVAIPE ADYREVDTLDRLIAYLGQRRQSGADGPSSQT NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgaattcgcaagtggtccgcaatgaggtgttgcgtgcattgaaaggcatcgccccggaa gtcgaagtcgaacagttgcacactgatcggttattgcgcgaagaggtggacctggactcc atggattggctgcgtttcatcgaggcgctgaatcgcagcctgggtgtcgccatacccgaa gccgattatcgcgaggtggataccttggacaggctcatcgcctacttgggacaaaggcgc cagtcgggcgccgacgggccatcgagccagacgtag

DBGET integrated database retrieval system