Pollutimonas thiosulfatoxidans: CKA81_01390 Help Entry CKA81_01390       CDS       T05795                                  Name (GenBank) hypothetical protein   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism pus  Pollutimonas thiosulfatoxidans Pathway pus00362   Benzoate degradation pus00621   Dioxin degradation pus00622   Xylene degradation pus01100   Metabolic pathways pus01120   Microbial metabolism in diverse environments pus01220   Degradation of aromatic compounds Brite KEGG Orthology (KO) [BR:pus00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     CKA81_01390    00622 Xylene degradation     CKA81_01390    00621 Dioxin degradation     CKA81_01390 Enzymes [BR:pus01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      CKA81_01390 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tautomerase Tautomerase_2 FAZ1_cons Motif Other DBs NCBI-ProteinID:  QAA92646 UniProt:  A0A410G8P5 LinkDB All DBs Position 288385..288576 Genome browser AA seq 63 aa AA seqDB search MPIIEVNMFEGRTSQQKREMISAVTQAVAQTLDVPETNVRIIIRELSKDNFGIGGKTAFE LGR NT seq 192 nt NT seq  +upstreamnt  +downstreamnt atgcccattattgaagtgaacatgttcgaaggaaggacgagccagcagaagcgcgagatg atctcggcggtaacgcaggcggtagcccagaccctagacgtgccagagaccaatgtaaga atcattattcgcgagttgagtaaagacaacttcggaatcggcggcaagacggcattcgag ttggggcgttag

DBGET integrated database retrieval system