Pollutimonas thiosulfatoxidans: CKA81_15850 Help Entry CKA81_15850       CDS       T05795                                  Symbol grxC Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism pus  Pollutimonas thiosulfatoxidans Brite KEGG Orthology (KO) [BR:pus00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:pus03110]     CKA81_15850 (grxC) Chaperones and folding catalysts [BR:pus03110]  Protein folding catalysts   Protein disulfide isomerase    CKA81_15850 (grxC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_2 GST_N_3 Glrx-like HrpB4 DSBA Motif Other DBs NCBI-ProteinID:  QAA95171 UniProt:  A0A410GFV4 LinkDB All DBs Position complement(3278401..3278658) Genome browser AA seq 85 aa AA seqDB search MANVTMYCTAVCPYCVRAEMLLKQRGVTDIQKIRIDLDPAQRDAMMARTGRRTVPQIYIG DTHVGGFDDLAALDRANGLMPLLTA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atggcaaacgtcaccatgtactgcacggcggtatgcccatattgcgtacgcgccgaaatg ctgcttaagcaacgcggcgttaccgacatccagaaaatccgtatcgacctggacccggcc cagcgcgacgccatgatggcacgcactggccggcgcaccgtgccgcagatttatatcggc gacacccacgtaggcggctttgacgacctggcggcgctggatcgcgccaacggcctgatg cccttgcttacggcctga

DBGET integrated database retrieval system