Pantoea vagans C9-1: Pvag_0895 Help Entry Pvag_0895         CDS       T01326                                  Symbol acpP Name (GenBank) Acyl carrier protein (ACP)   KO K02078   acyl carrier protein Organism pva  Pantoea vagans C9-1 Pathway pva00998   Biosynthesis of various antibiotics pva01100   Metabolic pathways pva01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pva00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Pvag_0895 (acpP)    00074 Mycolic acid biosynthesis     Pvag_0895 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Pvag_0895 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C TerB DUF1896 HLH Ribosomal_L50 DUF1493 Motif Other DBs NCBI-ProteinID:  ADO09092 LinkDB All DBs Position 933025..933261 Genome browser AA seq 78 aa AA seqDB search MSDIEQRVKKIISEQLGVKEEEVTNSASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINSHKG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgaacaacgcgttaagaaaatcatcagtgagcagctgggtgtgaaagag gaagaagtcaccaactctgcatctttcgtagaagacctgggtgccgattctcttgatacc gttgagctggtgatggctctggaagaagagtttgatactgagattccagacgaagaagct gagaaaatcactaccgttcaggcagcgatcgactacatcaatagccataaaggctaa

DBGET integrated database retrieval system