Polaromonas vacuolata: HC248_00395 Help Entry HC248_00395       CDS       T06542                                  Name (GenBank) hypothetical protein   KO K02398   negative regulator of flagellin synthesis FlgM Organism pvac  Polaromonas vacuolata Pathway pvac02020   Two-component system pvac02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:pvac00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     HC248_00395  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     HC248_00395  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:pvac02035]     HC248_00395 Bacterial motility proteins [BR:pvac02035]  Flagellar system   Flagellar assembly proteins    Others     HC248_00395 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FlgM Motif Other DBs NCBI-ProteinID:  QJC55132 UniProt:  A0A6H2H5H7 LinkDB All DBs Position complement(397763..398053) Genome browser AA seq 96 aa AA seqDB search MKIDPKINLLKPVSEASAPASNRDALAIKQAAAPSASSVQLTSATPQLPSTNSDFNTARV AKIREDISAGRYEVNPAKIADGLLASVRELLSSKPQ NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgaaaatagatcctaagattaaccttttaaagcccgtatccgaggccagcgcaccggcg tccaaccgagatgcgctcgcgatcaagcaggccgcagcgccaagcgctagctcagtgcaa ctgacttctgcgacgccgcagttgccatccacgaatagcgacttcaacaccgcgcgagtg gccaaaattcgcgaagacatcagcgctggacgttacgaagtgaatcccgcaaaaatcgca gatggcctgttggccagtgtgcgcgagctgctcagcagcaaaccgcaatga

DBGET integrated database retrieval system