KEGG   Pseudoalteromonas viridis: J5X90_18230
Entry
J5X90_18230       CDS       T07232                                 
Name
(GenBank) aminotransferase class III-fold pyridoxal phosphate-dependent enzyme
  KO
K21778  3-acetyloctanal aminotransferase [EC:2.6.1.-]
Organism
pvb  Pseudoalteromonas viridis
Pathway
pvb00333  Prodigiosin biosynthesis
pvb01100  Metabolic pathways
pvb01110  Biosynthesis of secondary metabolites
Module
pvb_M00837  Prodigiosin biosynthesis, L-proline => prodigiosin
Brite
KEGG Orthology (KO) [BR:pvb00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    J5X90_18230
Enzymes [BR:pvb01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.-
     J5X90_18230
SSDB
Motif
Pfam: Aminotran_3 AI-2E_transport
Other DBs
NCBI-ProteinID: QTL35420
LinkDB
Position
1:4143735..4146287
AA seq 850 aa
MKFGFIAHPTSVGLKRYVKMLDLLQRNTQDQHTGYNRELWGKANLVPFMNFAKITSASGA
TCEGMIKYMPLIAEEMIADPRGIAERVVAGVEEFVADGAELVGLGGFTSIVGRRGEATAA
KSPIPITSGNSLTTYAGYKALMQIKEWLDINPEKETVAIVGYPGSICLALSRLLLAEGYN
LKLLHRAGHKDKAEMLSHLPEQYHHRVSLTGNPDDLYGECKLFAGATSAGGVIDVAKLQP
GSIFIDVALPRDVNVDARPARDDILIIDGGCVTATDAVKLGGESLNVTIKQQLNGCMAET
IVLALEQRRENYSLGRYLEPVKVLEIGELAEKHGFYAYPLASFGERIDRQHVTNLKRYYH
QDIYAIDKGDTSKRLTFIDNILTQDPAKEDTLDRHHQFINPMMVEFLKQQRCDNVFRKAE
GTILYDNEGTGYLDMVAGYGCLNLGHNPTAVSEAVKTFLDEQGPNFIQYISVPEHTAKLA
EVLCHLAPGDMGRVFFSNSGTEAVEAAIKLAKAATGKPGIAYLKNSYHGKTLGALSITGR
EKHRKYFQPLIQAMVEVPFADLDALRDALQRDDVGALMLEPIQGEGGVHVPPAGYLSAVQ
QICRDTGTLLMVDEIQTGLARTGKLFACEWEGIEPDVLMLSKSLSGGLMPIGATLCRSDV
WQRAYGTSDRFLVHTSTFGGGNLASVAALTALREIVAQDLAARADELGSYFKAELQAIAD
KYPFVAEIRGKGLMLGIQFEQTFDGAVAASAREFATRLPGDWHSTWKFLPDPVREHLQAA
MERMEQTLGEMFCLKFVTKFCLDHQILTFVTANSSTVIRIQPPLVITKPEIDRFVSAFSA
VCEELSTFLD
NT seq 2553 nt   +upstreamnt  +downstreamnt
atgaagtttggatttatcgcccacccgacctcagtcggcctgaaacgctacgttaaaatg
ctcgatctgctgcaacgcaacacccaggatcagcataccggctacaaccgtgaactgtgg
ggcaaagccaacctggttccgtttatgaactttgccaaaatcacctcagccagcggcgcg
acctgtgaaggcatgatcaaatacatgccactgatagccgaagagatgattgccgatccc
agaggcattgccgagcgcgtggtcgccggtgtggaagagtttgtggctgacggcgcagag
ctggttggcctgggtggctttacctcaatcgttggtcggcgcggcgaagccaccgccgcc
aaatccccgatcccgattacctcgggcaactcactgaccacctatgccggctacaaagcc
ctgatgcagattaaagagtggctggacatcaacccggaaaaagaaaccgtggccatcgtc
ggctatccgggctcaatttgtctggcactcagccgcttattactcgccgaagggtataat
ctgaagctgctgcaccgcgccggccataaagacaaagcagaaatgctcagtcacctgccg
gagcaatatcaccatcgggtgagcctgacaggcaacccggacgacttgtatggcgagtgc
aagctgtttgctggtgccacctctgccggtggagtgatcgatgtagcgaaactgcaaccc
ggttccatctttattgatgtggcgctgccgcgggacgtcaatgtcgatgcccgtccggcc
cgcgatgacattttaatcatcgatggcggctgtgtgaccgccacagacgcagtgaaactg
ggtggtgagtcactgaatgtcaccatcaaacaacagctcaatggctgtatggccgaaacc
atagtgctggccctggagcagcgccgtgagaactactctctgggtcgttacctggagccg
gtaaaggtgttagaaatcggcgaactggccgaaaagcatggcttttatgcctatccgctg
gcctcctttggtgagcgtattgaccgccagcatgtcaccaacctgaagcgttattaccat
caggacatatatgccatcgacaaaggcgacaccagtaagagactgacctttatcgataac
atcctgacccaggatccagccaaagaagacaccctggaccgtcaccatcagtttattaac
cccatgatggtagaatttttaaaacaacagcgctgcgacaatgtgttccgtaaagccgaa
ggcactatcttgtatgacaatgaaggcaccggctatctcgacatggtggcaggctatggc
tgtctgaacctgggccataacccaaccgccgtcagcgaagcggtcaagaccttcctcgac
gaacagggccctaactttattcagtatatttctgtcccagagcacaccgccaagctggct
gaagtcttgtgtcatctggccccgggcgatatgggccgggtgtttttcagtaactcaggc
accgaagccgttgaggcggcgattaagctggccaaggccgcgaccggtaagccgggtatt
gcctatctgaaaaacagctaccacggaaaaaccctgggtgccctgtctattaccgggcgg
gaaaaacaccgtaagtacttccagccgctgatccaggccatggttgaggtgccgtttgcc
gacttggatgcactgcgtgacgccctgcaacgcgacgatgtgggtgcattgatgctggag
cccattcagggtgaaggcggcgtccatgtgccaccagccggatatctgagtgccgttcag
cagatctgtcgcgacacaggtactttgctgatggtcgatgagatccagaccggcctggcc
cgcaccggtaagctgtttgcctgtgaatgggaaggcattgaacccgatgtgctgatgctc
tcaaagtcgctgtccggcggactcatgcccatcggcgcgaccttgtgtcgcagcgatgtc
tggcagcgtgcctatggcacctcagatcgcttcttagtacatacctccacctttggtggc
ggcaacctcgcctcagtggccgcactgaccgcgctgcgagagatcgttgcgcaggatctg
gcggcgcgtgctgatgagctgggcagctatttcaaagctgagctccaggccattgccgat
aaatatccctttgttgccgaaattcgtggtaaaggcctgatgctggggatccagtttgag
cagacctttgacggagcggttgccgcctcggccagagagttcgccacgcgcctgccgggg
gactggcacagtacctggaagtttctgcccgatccggtccgcgagcacctgcaggcggcc
atggaacgcatggaacaaaccctgggcgaaatgttctgcctcaagtttgtcaccaagttc
tgtctggaccatcagatcctcacctttgtcaccgccaacagttcaacggtgatccggatc
cagccacctttggtgatcactaaacctgagattgaccgctttgtcagcgctttctctgcg
gtctgtgaagaactttcgacctttttagattaa

DBGET integrated database retrieval system