Pseudomonas viridiflava: CFBP1590_0306 Help Entry CFBP1590_0306     CDS       T06554                                  Name (GenBank) hypothetical protein   KO K09892   cell division protein ZapB Organism pvd  Pseudomonas viridiflava Brite KEGG Orthology (KO) [BR:pvd00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pvd03036]     CFBP1590_0306 Chromosome and associated proteins [BR:pvd03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     CFBP1590_0306 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Macoilin Bact_hydrolase ZapB Motif Other DBs NCBI-ProteinID:  SMS07891 UniProt:  A0A0D0KKW7 LinkDB All DBs Position I:complement(229193..229402) Genome browser AA seq 69 aa AA seqDB search MEDTDLQALMKRVELLLRHAEQLKSQNALLLAQEKSWREERAHLIEKNEIARQKVESMIS RLKALEQDS NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atggaagacaccgacctgcaagcgctgatgaaacgagtggagctgctgctcaggcacgcc gagcaacttaaatcccaaaacgcactcctattagctcaggaaaagtcctggcgcgaggaa cgcgcccacctcattgaaaagaacgaaatcgcccggcagaaggtcgagtcaatgatttcg cgcctcaaagctttggagcaagactcatga

DBGET integrated database retrieval system