Pseudomonas viridiflava: CFBP1590_0457 Help Entry CFBP1590_0457     CDS       T06554                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pvd  Pseudomonas viridiflava Pathway pvd00998   Biosynthesis of various antibiotics pvd01100   Metabolic pathways pvd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pvd00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CFBP1590_0457    00074 Mycolic acid biosynthesis     CFBP1590_0457   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CFBP1590_0457 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  SMS08042 UniProt:  A0A1Y6JGL4 LinkDB All DBs Position I:complement(395217..395477) Genome browser AA seq 86 aa AA seqDB search MSDLHLDIKVLIIDALGLEDITPQDIGNDQTLFGEGLGLDSVDALELGLAIQKRYGIKID ADAKDTRNHFANVDSLVAFVSARQPV NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgagcgatctacatctggacattaaagtgctgatcatcgacgccctgggcctcgaagac atcaccccgcaagacatcggcaatgaccagacgctcttcggcgagggccttggactggat tcggtcgacgcactggagctgggcctggccatccagaagcgctacggcatcaaaatcgat gccgacgccaaggacacccgcaaccatttcgccaacgtcgacagccttgtggcgttcgtc agcgccagacagccggtctga

DBGET integrated database retrieval system