Pseudomonas viridiflava: CFBP1590__1788 Help Entry CFBP1590__1788    CDS       T06554                                  Name (GenBank) Conserved hypothetical protein   KO K02078   acyl carrier protein Organism pvd  Pseudomonas viridiflava Pathway pvd00998   Biosynthesis of various antibiotics pvd01100   Metabolic pathways pvd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pvd00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CFBP1590__1788    00074 Mycolic acid biosynthesis     CFBP1590__1788   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CFBP1590__1788 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  SMS09374 UniProt:  A0A0D0M9K9 LinkDB All DBs Position I:1842911..1843120 Genome browser AA seq 69 aa AA seqDB search MEDKVLRLIEEAMEADEGSLSRGQNLDWDSIAVLTFMSLADEHLGKTLAANRLNGCKTVD DVIDLVTEK NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atggaagacaaagtactcaggctgatcgaagaagcgatggaagcagacgaaggcagtctg agccggggccagaaccttgactgggattccattgcggtcctgacattcatgtcgctggcc gacgaacatctgggcaagaccctggcggccaatcgtctcaacggctgcaagacggtggac gatgtgatcgatctcgtcacagagaagtaa

DBGET integrated database retrieval system