Pseudomonas viridiflava: CFBP1590__3811 Help Entry CFBP1590__3811    CDS       T06554                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism pvd  Pseudomonas viridiflava Pathway pvd00998   Biosynthesis of various antibiotics pvd01100   Metabolic pathways pvd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pvd00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CFBP1590__3811    00074 Mycolic acid biosynthesis     CFBP1590__3811   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CFBP1590__3811 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 TerB Ribosomal_L50 NirdL-like_HTH HLH Motif Other DBs NCBI-ProteinID:  SMS11397 UniProt:  A0A0D0MLW1 LinkDB All DBs Position I:complement(4237622..4237858) Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIVAEQLGVKEEEVVNTASFVEDLGADSLDTVELVMALEEEFETEIPDEEA EKITTVQAAIDYVNSHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagagcgcgtcaagaaaatcgttgccgagcaacttggcgtcaaggaa gaagaggttgtcaacactgcttctttcgttgaagacctgggcgctgactccctggacacc gttgagctggtaatggctctggaagaggaattcgagaccgaaatccctgacgaagaagcg gaaaagatcactaccgttcaagctgctatcgattacgtcaacagccaccaggcttaa

DBGET integrated database retrieval system