KEGG   Pandoraea vervacti: UC34_14365
Entry
UC34_14365        CDS       T03688                                 
Name
(GenBank) helicase
  KO
K03722  ATP-dependent DNA helicase DinG [EC:5.6.2.3]
Organism
pve  Pandoraea vervacti
Brite
KEGG Orthology (KO) [BR:pve00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pve03400]
    UC34_14365
Enzymes [BR:pve01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.3  DNA 5'-3' helicase
     UC34_14365
DNA repair and recombination proteins [BR:pve03400]
 Prokaryotic type
  Other factors with a suspected DNA repair function
   DNA helicases
    UC34_14365
SSDB
Motif
Pfam: Helicase_C_2 DEAD DEAD_2 ResIII Helicase_C
Other DBs
NCBI-ProteinID: AJP57845
UniProt: A0ABN4G2M0
LinkDB
Position
complement(3276351..3278588)
AA seq 745 aa
MTDSAASDPADLSPSADTPTFHGLKPLAPKRERELQEIFGDGGMLARAIDGYRSREPQTE
MARAVAAAMDTHDTLIAEAGTGTGKTYAYLVPAMLWGGKTIISTGTKHLQDQIFARDIPT
VRKALAVPVTVAMLKGRSNYLCHYYLERAQQEGRFASRHEAAQLREITTFAQITHSGDKA
ELASVPENAPIWAQVTSTRDNCLGQECPRYKDCFVMLARKEAQQADLVVVNHHLFFADVM
LRDTGMAELLPSANTVIFDEAHQLPETATLFFGETVSTSQLLELARDCVAEGLIHARDAA
DWVKLGANLERSARDVRLTFGQDNTRMSVTQLPDDHELFGALESVDLSLQDLIETLQHQA
ERAEALGACLRRALELHEQLERWQLGVTPPTPDEQPLPLLDPDAPRVTDGKREKAAKAAK
AATAREAQAARLATQAEAAGTDLQGDGPSDKTYTPPETVRWIEVFSQTVQLHQTPLSIAP
IFAKQRAGAPRAWIFTSATLSVKGNFMHYAAQLGLDAQKSLTLASPFDYPNQSLLYVPRG
LPQPSAPNFTDAVLDAALPVLEVSGGRAFVLCTTLRAVNRAAERLREEFERRGWPYPLLV
QGEASRTELLDRFRALGNAVLIGSQSFWEGVDVRGEALSLVIIDKLPFAPPDDPVLAARL
DALTKKGLSPFAVHQLPQAVITLKQGAGRLIRSEADRGVLMICDPRLVDKPYGRRIWQSL
PPFKRTRELPIVRGFFDEIAAQAGS
NT seq 2238 nt   +upstreamnt  +downstreamnt
ttgaccgattccgccgccagcgatcccgccgacctctcccccagcgccgatacccccaca
tttcacggactcaagccgcttgcgcccaagcgtgagcgcgagttgcaggaaatcttcggt
gacggcggcatgctcgcgcgtgccatcgacggctaccgctcgcgcgagccgcagaccgag
atggcgcgcgccgtggccgccgcgatggacacccacgacacactgatcgccgaagcgggc
accggcacgggcaagacctacgcgtatctcgtgccggccatgctatggggcggcaagacg
atcatctcgaccggtaccaagcatttgcaggaccagatcttcgcgcgggatattcccacc
gtgcgcaaggcgctcgccgtgccggtgacggtcgccatgctcaaggggcgttcgaactat
ctgtgtcactactatctcgaacgcgcccagcaggaggggcgtttcgcttcgcgccacgag
gcggcgcaactgcgtgagatcacgacgttcgcgcagatcacgcacagcggcgacaaggcc
gaactcgcctcggtgccggagaatgcgccgatctgggcacaggtgacctccacccgcgac
aactgcctgggacaggaatgcccgcgttacaaggactgctttgtgatgctcgcgcgcaag
gaggcgcaacaggccgacctcgtggtggtcaatcaccacctgttctttgccgacgtgatg
ctgcgcgatacgggcatggcggaactgttgccgagtgcgaacacggtgattttcgacgaa
gcgcatcagttgccggagacggccacgctgttcttcggcgagacggtgtcgaccagccaa
ctgcttgaattggcgcgcgattgcgtagccgaagggctgattcacgcgcgtgacgctgcc
gactgggtcaagctcggtgcgaacctcgagcgctcggcacgcgacgtgcgtctgacgttc
gggcaggacaacacgcgcatgtccgtgacgcaattgccggacgatcacgaactgttcggc
gcgctcgagagtgtcgatctctcgctgcaagacctgatcgaaacgctccagcatcaggcg
gaacgcgccgaggcgctgggcgcttgtctgcgtcgtgcgttggagttgcacgagcaactt
gagcgctggcagttgggggtgacaccgccgacgccggacgagcagccgctgccgttgctg
gacccggacgcgccgcgtgttacggacggcaagcgggaaaaagcggcgaaggctgcgaag
gccgcgacggcgcgcgaagcgcaagccgcgcggctggccacccaggcggaggccgctggc
accgacttgcaaggcgatggcccgtcggacaaaacctatacgccgcccgagacggttcgc
tggatcgaagtcttttcgcagacggtgcagttgcaccagacgccgctgtcgattgcgccg
atcttcgcgaagcagcgtgccggtgcgccgcgtgcgtggattttcacgtcggcgacgttg
tccgtgaagggcaacttcatgcactacgccgcccagttgggcctcgacgcacagaagtcc
ctcacgctggccagtccgttcgactatccgaaccagagcctgttgtacgtgccacgagga
ttgccgcaaccgtctgcccccaactttacggatgcggtgctcgacgccgcattgccggtg
ttggaggtgagcggcgggcgggcgttcgtgctctgtacgacattgcgtgcggtgaaccgg
gccgcggaacgtctgcgcgaagagttcgaacgtcgcgggtggccttacccgttgctcgtg
cagggcgaggcaagccgcacggaattgctcgaccgcttccgcgcgctgggcaatgcggtg
ctgatcggcagccagagtttctgggaaggggtggatgtgcgtggcgaggcgctctcgctc
gtcattatcgacaagctgccgtttgccccgcccgacgacccggtgctggcagcgcgcctc
gacgcgctgacgaagaaggggctgagtccgtttgcggtgcaccagttgccgcaggccgtg
attacgctcaaacaaggggcggggcgtctgattcgttccgaggccgaccggggcgtgttg
atgatctgcgatccgcgtctcgtggacaaaccttacggccgtcgcatctggcagagcttg
ccgccattcaagcgcacccgcgagctgccgatcgtgcgcggtttcttcgacgagatcgcg
gcacaggccggtagctga

DBGET integrated database retrieval system