Pandoraea vervacti: UC34_19035 Help Entry UC34_19035        CDS       T03688                                  Name (GenBank) DNA-binding protein   KO K03746   DNA-binding protein H-NS Organism pve  Pandoraea vervacti Brite KEGG Orthology (KO) [BR:pve00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pve03036]     UC34_19035    03400 DNA repair and recombination proteins [BR:pve03400]     UC34_19035 Chromosome and associated proteins [BR:pve03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     UC34_19035 DNA repair and recombination proteins [BR:pve03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       UC34_19035 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS DUF4515 FERM_f0 Motif Other DBs NCBI-ProteinID:  AJP58482 UniProt:  A0ABM5T156 LinkDB All DBs Position complement(4399950..4400240) Genome browser AA seq 96 aa AA seqDB search MASYKELVAQRDKIEKQIEEARAREVAEVIAAVKQKIQEYDLTAKDLGLATSDGRRRAVR AQIAPKYMNPATGETWSGRGRAPKWVGKNKEKFLIK NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atggcaagctataaggaactggtcgcgcaacgcgacaaaatcgaaaagcagatcgaagag gcccgtgcccgtgaagtggccgaggtcattgccgccgtcaagcagaagatccaggaatat gatctcactgcgaaggatctgggtcttgccacgtcggacggccgccgccgcgccgttcgt gcgcaaatcgctccgaaatacatgaacccggctaccggcgaaacgtggtcgggccgtggc cgcgcgccgaagtgggtcgggaagaacaaagagaaattcctgatcaagtaa

DBGET integrated database retrieval system