KEGG   Paracoccus versutus: E3U25_23600
Entry
E3U25_23600       CDS       T09188                                 
Name
(GenBank) peptidylprolyl isomerase
  KO
K03771  peptidyl-prolyl cis-trans isomerase SurA [EC:5.2.1.8]
Organism
pver  Paracoccus versutus
Brite
KEGG Orthology (KO) [BR:pver00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:pver03110]
    E3U25_23600
Enzymes [BR:pver01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     E3U25_23600
Chaperones and folding catalysts [BR:pver03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Parvulin
    E3U25_23600
SSDB
Motif
Pfam: Rotamase Rotamase_3 SurA_N SurA_N_3 Rotamase_2
Other DBs
NCBI-ProteinID: WGR58878
LinkDB
Position
complement(2507485..2508765)
AA seq 426 aa
MRRILLGAAMAAMLAAGGVAPAFAQGNPFQPLVYVNDSAVTRYELEQRIRFLQILRAPDA
DRASAEQALIDDRLRLFAANQMGITASDAQIDAGLAEFAGRANLGVEEFTRALAQAGVEQ
QTFRDFVAAGIVWREVVRQRLVPQVQVSDAELDQEMQRLIETPRITHVALSELIIPAPPG
QEAQAMGLAESLVQSVRSEADFAAAARQHSATPSAEESGRLPWMPLENLPPSLRPIILSM
KPGQISQPLTVEGAVVLFFLRDSRGALRPGAREQVLDYVRFRLASLAEANRIAALSDSCA
DLFVHARGLPPEQIQRQTLPQGQIPAAEALRLAVLDDNETSVVSQGGAAELLMLCKRQSA
LLASGAAAEAPVAVAVTAEGEAAAAPDPDTLPDREEMRSQIFSRKVGQAADNYLAELRAN
AIIRRP
NT seq 1281 nt   +upstreamnt  +downstreamnt
atgcggcgaattcttctgggggcggccatggccgcgatgctggcagcaggcggggtggcc
ccggcctttgcgcagggcaatccgttccagccgctggtctatgtcaacgattcggccgtc
acccgctatgagctggaacagcgcatccgcttcctgcagatcctgcgcgcgcccgatgcc
gaccgcgcctcggccgagcaggcgctgatcgacgaccggctgcgcctgtttgccgcgaac
cagatgggcatcaccgccagcgacgcccagatcgacgccggcctggccgagttcgccggc
cgcgccaatcttggcgtcgaggaattcacccgcgccctggcccaggccggggtcgaacag
cagaccttccgcgatttcgtcgccgccggcattgtctggcgcgaggtggtgcgccagcgc
ctggtgccgcaggtccaggtcagcgacgccgagctggaccaggaaatgcagcgcctgatc
gagacgccgcgcatcacccatgtcgcgctgtccgaactgatcatccccgcgccgcccggc
caggaggcgcaggccatgggcctggcggaatcgctggtgcagagcgtgcgctcggaggcg
gatttcgccgcggcggcgcggcagcattccgcgacgccctcggccgaggaaagcgggcgg
ctgccctggatgccgctggagaacctgccgccctcgctgcggccgatcatcctgtcgatg
aagcccggccagatcagccagcccctgaccgtcgagggcgcggtggtgctgttcttcctg
cgcgacagccgcggcgcgctgcgtcccggcgccagggaacaggtgctggactacgtgcgc
ttccggctggccagcctggccgaggcgaaccggatcgcggcgctttccgacagctgcgcc
gatcttttcgtccatgcccgcggcctgccgcccgagcagatccagcgccagaccctgccg
caaggccagatcccggccgccgaggcgctgcggctggcggtgctggacgacaatgagacc
tcggtggtcagccagggcggcgcggccgaattgctgatgctgtgcaagcgccagtccgcg
ctgctggcctccggcgccgcggcggaggcgccggtggcggtggcggtgacggccgagggc
gaggcggccgccgcgcccgatcccgacacgctgccggaccgtgaagagatgcgcagccag
atcttcagccgcaaggtcggccaggcagccgacaactacctggccgagttgcgggccaat
gcaatcatccggcggccttga

DBGET integrated database retrieval system