Prevotella veroralis: J5A55_06780
Help
Entry
J5A55_06780 CDS
T08190
Name
(GenBank) 50S ribosomal protein L18
KO
K02881
large subunit ribosomal protein L18
Organism
pvf
Prevotella veroralis
Pathway
pvf03010
Ribosome
Brite
KEGG Orthology (KO) [BR:
pvf00001
]
09120 Genetic Information Processing
09122 Translation
03010 Ribosome
J5A55_06780
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03011 Ribosome [BR:
pvf03011
]
J5A55_06780
Ribosome [BR:
pvf03011
]
Ribosomal proteins
Mitochondria/ Chloroplast
Large subunit
J5A55_06780
Bacteria
J5A55_06780
Archaea
J5A55_06780
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Ribosomal_L18p
Motif
Other DBs
NCBI-ProteinID:
QUB40427
LinkDB
All DBs
Position
1:complement(1602764..1603108)
Genome browser
AA seq
114 aa
AA seq
DB search
MTTKKEQRRIKIKFRIRKSVNGTAERPRLSVFRSNKQIYAQVINDLTGTTLASASSLGLE
KMAKIDQAKKVGALVAEHAKAAGVEQVVFDRNGYLYHGRVQALADAAREGGLKF
NT seq
345 nt
NT seq
+upstream
nt +downstream
nt
atgacaacaaagaaagaacaaagaagaattaagataaagttccgcattcgtaagagtgtg
aacggtactgctgaacgcccacgcttgagcgttttccgcagtaataagcagatttatgca
caggttattaacgatctgaccggaacaacccttgcttcagcttcttcacttggccttgag
aaaatggctaagattgatcaggctaagaaggtaggtgcgctcgttgctgagcatgctaag
gctgctggtgtagagcaggttgtttttgaccgtaacggttatctctatcacggacgtgta
caggctttggctgatgctgcacgtgagggaggacttaaattctaa
DBGET
integrated database retrieval system