Proteus vulgaris: CRN77_10615 Help Entry CRN77_10615       CDS       T05486                                  Name (GenBank) anti-sigma-28 factor FlgM   KO K02398   negative regulator of flagellin synthesis FlgM Organism pvg  Proteus vulgaris Pathway pvg02020   Two-component system pvg02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:pvg00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     CRN77_10615  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     CRN77_10615  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:pvg02035]     CRN77_10615 Bacterial motility proteins [BR:pvg02035]  Flagellar system   Flagellar assembly proteins    Others     CRN77_10615 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FlgM Motif Other DBs NCBI-ProteinID:  ATN00147 LinkDB All DBs Position complement(2384523..2384822) Genome browser AA seq 99 aa AA seqDB search MSIERANPLLPINAIAQRNPGEVTQGSRKSGTTEQKTATGDTSVKLSEAQKKLVQPGNKD IDVEKVARLKEAIANGTLTMDSGKIADALFREAAESITQ NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgagtattgaacgcgcgaatccactgcttccgattaacgcaattgcacaacgtaaccca ggtgaagtcactcaaggctcacgtaaatcgggaacgactgaacaaaaaactgcaacaggc gatacttctgtaaagctaagtgaagctcagaaaaaacttgttcaacctggaaataaagac attgacgttgagaaagttgctcgcttaaaagaagcaattgccaacggaacattaaccatg gacagcggtaaaattgcggacgctcttttccgtgaagctgctgaaagcataactcaataa

DBGET integrated database retrieval system