Panicum virgatum (switchgrass): 120643538 Help Entry 120643538         CDS       T07260                                  Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism pvir  Panicum virgatum (switchgrass) Brite KEGG Orthology (KO) [BR:pvir00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:pvir03041]     120643538   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pvir04052]     120643538 Spliceosome [BR:pvir03041]  Complex B   Other components    Complex B specific factors     120643538 Cytokines and neuropeptides [BR:pvir04052]  Neuropeptides   Unclassified    120643538 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Rad60-SLD Ubiquitin_4 OTU1_UBXL Motif Other DBs NCBI-GeneID:  120643538 NCBI-ProteinID:  XP_039775862 LinkDB All DBs Position 8K:2863427..2866923 Genome browser AA seq 73 aa AA seqDB search MIEVVLNDRLGKKVRVKCNEDDTIGDLKKLVAAQTGTRPEKIRIQKWYNIYKDHITLKDY EIHDGMGLELYYN NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgatcgaggtggttctgaacgaccggctggggaagaaggtgcgggtcaagtgcaacgag gacgacaccatcggcgacctcaagaagctggtggcggcgcagacggggacgcgccccgag aagatccgcatccagaagtggtacaacatctacaaggaccacatcaccctcaaggactac gagatccacgacggcatgggcctcgagctctactacaactag

DBGET integrated database retrieval system