Panicum virgatum (switchgrass): 120657211 Help Entry 120657211         CDS       T07260                                  Name (RefSeq) rac-like GTP-binding protein 3   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism pvir  Panicum virgatum (switchgrass) Pathway pvir04145   Phagosome pvir04148   Efferocytosis pvir04517   IgSF CAM signaling pvir04518   Integrin signaling pvir04620   Toll-like receptor signaling pathway pvir05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:pvir00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     120657211    04518 Integrin signaling     120657211  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     120657211    04148 Efferocytosis     120657211  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     120657211  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     120657211  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pvir04131]     120657211   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pvir04147]     120657211    04031 GTP-binding proteins [BR:pvir04031]     120657211 Membrane trafficking [BR:pvir04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     120657211  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     120657211   Macropinocytosis    Ras GTPases     120657211  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     120657211 Exosome [BR:pvir04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    120657211   Exosomal proteins of other body fluids (saliva and urine)    120657211   Exosomal proteins of colorectal cancer cells    120657211   Exosomal proteins of bladder cancer cells    120657211 GTP-binding proteins [BR:pvir04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     120657211 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  120657211 NCBI-ProteinID:  XP_039791419 LinkDB All DBs Position 1N:complement(60794755..60797916) Genome browser AA seq 214 aa AA seqDB search MASSASRFIKCVTVGDGAVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVDGTTVNLGL WDTAGQEDYNRLRPLSYRGADVFVLAFSLVSRASYENIMKKWIPELQHYAPGVPIVLAGT KLDLREDKHYLMDHPGLVPVTTVQGEELRRQIGAMYYIECSSKTQQNVKAVFDAAIKVVI QPPTKLREKKKKKSRKGCSMMDVFCGRKMLCFKS NT seq 645 nt NT seq  +upstreamnt  +downstreamnt atggcgtccagcgcctcccggttcatcaagtgcgtcacggtcggcgacggcgcagttggc aagacctgtatgctcatctgctacaccagcaacaagttccccaccgactacatacctact gtgttcgacaatttcagcgcaaacgtagttgtggatggcaccacggtgaacttaggcctt tgggatactgcggggcaggaagattacaaccgactgaggcctctaagctaccgtggtgct gatgttttcgtgcttgccttctcacttgtgagccgagctagctacgagaacatcatgaag aagtggataccggagcttcagcattatgcacctggggtgcccattgttttggcaggcacg aaattggatcttcgtgaagacaagcactacttgatggaccatcctgggttggtgcctgtt accacagtgcagggggaggaacttcgtagacaaattggtgctatgtattatattgagtgc agctcaaagacacagcagaatgtcaaagctgtgtttgatgctgccatcaaggtagtaatc cagcctccaactaaactaagagaaaagaagaaaaagaaatcacgcaaaggatgttccatg atggacgttttctgtggaaggaaaatgctatgcttcaaatcctga

DBGET integrated database retrieval system