Panicum virgatum (switchgrass): 120659004 Help Entry 120659004         CDS       T07260                                  Name (RefSeq) SKP1-like protein 1   KO K03094   S-phase kinase-associated protein 1 Organism pvir  Panicum virgatum (switchgrass) Pathway pvir03083   Polycomb repressive complex pvir04120   Ubiquitin mediated proteolysis pvir04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:pvir00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     120659004    04120 Ubiquitin mediated proteolysis     120659004   09126 Chromosome    03083 Polycomb repressive complex     120659004  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pvir04131]     120659004    04121 Ubiquitin system [BR:pvir04121]     120659004    03036 Chromosome and associated proteins [BR:pvir03036]     120659004 Membrane trafficking [BR:pvir04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     120659004 Ubiquitin system [BR:pvir04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      120659004    Cul7 complex      120659004 Chromosome and associated proteins [BR:pvir03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      120659004   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      120659004 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1 Period_C Motif Other DBs NCBI-GeneID:  120659004 NCBI-ProteinID:  XP_039793023 LinkDB All DBs Position 2N:66168613..66169401 Genome browser AA seq 131 aa AA seqDB search MIADGCIKLEKIGSETPDPEKLVDYCNKHANSIPSAASSSSSLLTAPSKELEDWDRKLVD CLSQDALFSLAEASDSLIMDGLLDLTCREIDDLMKGKTIDEMRKMFNIKNDFTKEQEEEI RRKHAWAFGDA NT seq 396 nt NT seq  +upstreamnt  +downstreamnt atgatcgccgacggctgcatcaagctcgagaagatcgggtccgagacccccgaccccgag aagctggtggactactgcaacaagcacgccaactccatccccagcgccgcgtccagcagc agcagcctcctcaccgcgccatccaaggagctggaggattgggaccgcaagctcgtcgat tgcctcagccaggacgccctcttcagcctcgccgaggcctccgactccctcatcatggac gggctcctcgacctcacctgccgcgagatcgacgacctgatgaagggcaagaccatcgat gagatgcgcaagatgttcaacatcaagaatgacttcacaaaggagcaggaggaggagatt cgccggaagcacgcctgggccttcggcgacgcctag

DBGET integrated database retrieval system