Panicum virgatum (switchgrass): 120665631 Help Entry 120665631         CDS       T07260                                  Name (RefSeq) sm-like protein LSM5   KO K12624   U6 snRNA-associated Sm-like protein LSm5 Organism pvir  Panicum virgatum (switchgrass) Pathway pvir03018   RNA degradation pvir03040   Spliceosome Brite KEGG Orthology (KO) [BR:pvir00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     120665631   09123 Folding, sorting and degradation    03018 RNA degradation     120665631  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:pvir03019]     120665631    03041 Spliceosome [BR:pvir03041]     120665631 Messenger RNA biogenesis [BR:pvir03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      120665631   mRNA degradation factors    5'-3' decay     Lsm complex      120665631 Spliceosome [BR:pvir03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     120665631 SSDB OrthologParalogGFIT Motif Pfam:  LSM DUF7452 Motif Other DBs NCBI-GeneID:  120665631 NCBI-ProteinID:  XP_039801178 LinkDB All DBs Position 3N:30200981..30204583 Genome browser AA seq 88 aa AA seqDB search MSQNNPSQLLPSELIDRCIGSKIWVIMKGDKELVGTLCGFDVYVNMVLEDVTEYEYTAEG RRITKLDQILLNGNNIAILVPGGSPPDV NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgtcccagaacaacccctcccagctcctcccctcagagctgatcgaccgctgcatcggg tccaagatctgggtgatcatgaagggggacaaggagctcgtcggcaccctctgcggcttc gacgtctacgtcaacatggtgctggaggacgtcaccgagtatgaatacacggctgaaggg cgtcgcattacaaaacttgaccagatactgctgaacggcaacaacatagccattttggtt cctggtggttcaccacccgatgtgtaa

DBGET integrated database retrieval system