Panicum virgatum (switchgrass): 120697072 Help Entry 120697072         CDS       T07260                                  Name (RefSeq) rac-like GTP-binding protein 1   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism pvir  Panicum virgatum (switchgrass) Pathway pvir04145   Phagosome pvir04148   Efferocytosis pvir04517   IgSF CAM signaling pvir04518   Integrin signaling pvir04620   Toll-like receptor signaling pathway pvir05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:pvir00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     120697072    04518 Integrin signaling     120697072  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     120697072    04148 Efferocytosis     120697072  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     120697072  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     120697072  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pvir04131]     120697072   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pvir04147]     120697072    04031 GTP-binding proteins [BR:pvir04031]     120697072 Membrane trafficking [BR:pvir04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     120697072  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     120697072   Macropinocytosis    Ras GTPases     120697072  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     120697072 Exosome [BR:pvir04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    120697072   Exosomal proteins of other body fluids (saliva and urine)    120697072   Exosomal proteins of colorectal cancer cells    120697072   Exosomal proteins of bladder cancer cells    120697072 GTP-binding proteins [BR:pvir04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     120697072 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  120697072 NCBI-ProteinID:  XP_039836134 LinkDB All DBs Position 3K:5877083..5880396 Genome browser AA seq 216 aa AA seqDB search MSAAAASSVAKFIKCVTVGDGAVGKTCMLICYTCNKFPTDYIPTVFDNFSANVSVDGSIV NLGLWDTAGQEDYSRLRPLSYRGADVFILSFSLVSRASYENVLKKWMPELRRFSPTIPVV LVGTKLDLREDRSYLADHPAASIITTEQGEELRKQIGAVAYIECSSKTQRNIKAVFDTAI KVVLQPPRRREVTRKKMKTSSNQSVRRYFCGNACFR NT seq 651 nt NT seq  +upstreamnt  +downstreamnt atgagtgcggcggcggcgagctcggtcgccaagttcatcaagtgcgtcaccgtcggggac ggtgccgtggggaagacctgcatgctcatctgctacacctgcaacaagttccccacggat tacatccccactgtattcgacaacttcagtgccaatgtctcggtggatgggagcatcgtc aacttgggcctctgggacacggcaggtcaggaggattacagcagattgaggcctcttagc tacaggggtgcggatgtgttcatcctctccttctctctggtcagcagggcaagctatgag aatgtcttgaagaagtggatgccagagcttcgccgattttcacctaccattcctgtagtt cttgttggaaccaaactagatctccgtgaagacagatcttatcttgctgaccatcctgcc gcttctatcatcactactgaacagggagaggaactcagaaagcagataggtgctgtggcc tatatagaatgcagctcaaagacacagcggaacataaaagctgtgttcgacactgcgatt aaagtagtgcttcaaccaccaaggcgaagagaagttaccaggaagaaaatgaaaacaagt tcgaatcagtctgtgaggagatacttttgtggaaacgcctgtttcagataa

DBGET integrated database retrieval system