Panicum virgatum (switchgrass): 120698136 Help Entry 120698136         CDS       T07260                                  Name (RefSeq) rac-like GTP-binding protein 2   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism pvir  Panicum virgatum (switchgrass) Pathway pvir04145   Phagosome pvir04148   Efferocytosis pvir04517   IgSF CAM signaling pvir04518   Integrin signaling pvir04620   Toll-like receptor signaling pathway pvir05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:pvir00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     120698136    04518 Integrin signaling     120698136  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     120698136    04148 Efferocytosis     120698136  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     120698136  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     120698136  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pvir04131]     120698136   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pvir04147]     120698136    04031 GTP-binding proteins [BR:pvir04031]     120698136 Membrane trafficking [BR:pvir04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     120698136  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     120698136   Macropinocytosis    Ras GTPases     120698136  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     120698136 Exosome [BR:pvir04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    120698136   Exosomal proteins of other body fluids (saliva and urine)    120698136   Exosomal proteins of colorectal cancer cells    120698136   Exosomal proteins of bladder cancer cells    120698136 GTP-binding proteins [BR:pvir04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     120698136 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA Motif Other DBs NCBI-GeneID:  120698136 NCBI-ProteinID:  XP_039837579 LinkDB All DBs Position 3K:complement(19256848..19259729) Genome browser AA seq 212 aa AA seqDB search MSVTKFIKCVTVGDGAVGKTCMLICYTSNKFPTDYIPTVFDNFSANVSVDGNIVNLGLWD TAGQEDYSRLRPLSYRGADVFVLAFSLISRASYENVLKKWVPELRRFAPNVPVVLVGTKL DLRDHRAYLADHPGASTITTAQGEELRKQIGAAAYIECSSKTQQNVKAVFDTAIKVVLQP PRRREAMPARRKSRRGSGCSIMNLMCGSTCAA NT seq 639 nt NT seq  +upstreamnt  +downstreamnt atgagcgtgaccaagttcatcaagtgcgtgacggtgggcgacggcgcggtgggcaagacc tgcatgctcatctgctacaccagcaacaagttccccacggactacatccctacggtgttc gacaacttcagcgccaacgtctccgtggatggcaacatcgtcaacttgggcctctgggac actgctgggcaagaggactacagcaggctgaggccgctgagctacaggggcgcagacgtg ttcgtgctggccttctccctgatcagcagggcaagctatgagaatgttcttaagaagtgg gtgccagagctgcgcagatttgcacccaatgttccagttgttcttgttgggaccaagtta gatctccgtgaccacagagcctaccttgctgaccatcccggagcttcaacaatcacaacg gcacagggtgaagaactgaggaagcagattggtgctgcagcttacatcgagtgcagttcc aaaacgcagcagaatgtcaaggctgtctttgatactgccatcaaagtggtccttcagccc cctcggagaagggaggcaatgcctgcaaggaggaaaagtaggcgcggctctggatgctcc attatgaacctgatgtgtggcagcacgtgtgctgcttag

DBGET integrated database retrieval system