KEGG   Panicum virgatum (switchgrass): 120699474
Entry
120699474         CDS       T07260                                 

Name
(RefSeq) nicotianamine aminotransferase 1-like
  KO
K14271  nicotianamine aminotransferase [EC:2.6.1.80]
Organism
pvir  Panicum virgatum (switchgrass)
Pathway
pvir00997  Biosynthesis of various secondary metabolites - part 3
Brite
KEGG Orthology (KO) [BR:pvir00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00997 Biosynthesis of various secondary metabolites - part 3
    120699474
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pvir01007]
    120699474
Enzymes [BR:pvir01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.80  nicotianamine aminotransferase
     120699474
Amino acid related enzymes [BR:pvir01007]
 Aminotransferase (transaminase)
  Others
   120699474
SSDB
Motif
Pfam: Aminotran_1_2 Beta_elim_lyase Aminotran_5 Cys_Met_Meta_PP Glyco_hydro_20 Aminotran_3
Other DBs
NCBI-GeneID: 120699474
NCBI-ProteinID: XP_039839414
LinkDB
Position
1K
AA seq 453 aa
MAMTHHQNGGATAARAAEDGNINGNGHAAAAAEWRFARAAKEGALAAAGDKMSIRAVRFK
ISASVDARDPRPVLPLAHGDPSVLPAFRTAAEAEEAVAAALRTGRLNCYPAGVGLPDARR
ALAKHLSRDLPYDLSSDDIFLTAGGTQAIEVVISVLAQPGTNILLPRPGYPNYEARAALN
NLEVRHFDLIPEKGWEIDIDSLESIADKNTAAMVIINPNNPCGSVYTREHLAKVAEAARK
LGILVIADEVYGNLVFGDSQFIPMGVFGHIAPVLSIGSLSKRWIVPGWRLGWVAACDPKK
ILQETKILTSITNFLNVSTDPATFIQGALPQILENTKEDFFKRIIGLLEETSDICYREIK
DIKYITCPHKPEGSMFVMVKLNLYLLEGIHDDIDFCCKLAKEESVILCPGSVLGMKNWVR
ITFAIDSSSLLDGLERIKSFCQRHKKKNLLNGI
NT seq 1362 nt   +upstreamnt  +downstreamnt
atggcgatgacccaccaccagaacggcggcgccaccgccgcccgtgctgcggaggacggc
aacatcaacggcaacggccacgcggcggcggcggcggagtggcggttcgcgcgggcggcg
aaggagggcgcgctggcggcggcgggggacaagatgagcatccgcgcggtgcggttcaag
atcagcgcgagcgtggacgcgcgcgacccgcggcccgtgctgccgctggcgcacggggac
ccctccgtgctcccggccttccgcaccgccgccgaggccgaggaagccgtcgccgccgcg
ctccggacgggcaggctcaactgctaccccgccggcgtcggcctgcccgacgcccgccgt
gctttggcgaagcacctgtcgcgtgatcttccatacgacctatcctccgacgacatcttc
ctcaccgctggaggcactcaagccatcgaggtggtgatctcagttctagcccaaccgggc
accaacatattgctgccaagacccgggtatccaaactacgaggcgcgcgccgcgctgaac
aacttagaggttcgccacttcgatctgattcctgagaaagggtgggagatcgacatagac
tctctggagtctattgctgacaagaacaccgccgcaatggtcatcatcaaccccaacaac
ccttgtgggagtgtgtacacccgtgaacatttggccaaggttgccgaggcagcaaggaag
cttgggatcttagtcattgctgacgaagtgtatggcaatttggttttcggggactcccag
ttcatcccaatgggcgtctttgggcacatcgccccagtgttgagcataggatcactctca
aagagatggatagtgcctggatggagacttggctgggttgctgcatgcgatcccaagaag
atcctgcaagaaactaagattcttacgtcaatcacaaacttccttaatgtttcaactgat
ccagcaactttcattcagggagcacttccacaaattcttgagaacacaaaggaagatttc
ttcaagaggatcattggtttgctagaggaaacatcagatatatgttatagagaaataaag
gacatcaaatacattacttgtccgcacaagccagaaggttccatgtttgtgatggtgaag
ctgaatttgtatcttctggaggggatccatgatgacattgatttttgctgcaagctggca
aaagaagaatcggtgattttgtgcccagggagtgttctgggaatgaaaaactgggttcgg
ataacgtttgccattgattcatcttctcttctggatggccttgagaggatcaaatctttc
tgccaaaggcacaagaagaagaatctgcttaatggcatctaa

DBGET integrated database retrieval system