Panicum virgatum (switchgrass): 120699755 Help Entry 120699755         CDS       T07260                                  Name (RefSeq) rac-like GTP-binding protein 7   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism pvir  Panicum virgatum (switchgrass) Pathway pvir04145   Phagosome pvir04148   Efferocytosis pvir04620   Toll-like receptor signaling pathway pvir05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:pvir00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     120699755    04148 Efferocytosis     120699755  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     120699755  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     120699755  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pvir04131]     120699755   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pvir04147]     120699755    04031 GTP-binding proteins [BR:pvir04031]     120699755 Membrane trafficking [BR:pvir04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     120699755  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     120699755   Macropinocytosis    Ras GTPases     120699755  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     120699755 Exosome [BR:pvir04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    120699755   Exosomal proteins of other body fluids (saliva and urine)    120699755   Exosomal proteins of colorectal cancer cells    120699755   Exosomal proteins of bladder cancer cells    120699755 GTP-binding proteins [BR:pvir04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     120699755 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Sua5_C AAA_7 Motif Other DBs NCBI-GeneID:  120699755 NCBI-ProteinID:  XP_039839754 LinkDB All DBs Position 1K:22447747..22450089 Genome browser AA seq 197 aa AA seqDB search MSTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWD TAGQEDYNRLRPLSYRGADVFLLAFSLISRASYENIHKKWIPELRHYAPNVPIVLVGTKL DLREDKQFFLDHPGLAPITTAQGEELKRMIGAAAYIECSSKTQQNVKAVFDSAIKVVLCP PKPKKKSARKQRSCWIL NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atgagcacggcaaggttcatcaagtgcgtgacggtcggcgacggcgccgtcggcaagacc tgcatgctcatctcctacaccagcaacaccttccccacggattatgtgcccacggtgttc gacaacttcagcgccaacgtcgtcgtcgacggcaacacggtgaacctcggcctctgggat accgccggacaagaggactacaacaggctgaggcctcttagctacagaggggctgatgtt tttctattagcattttccctcatcagcagagcgagctacgagaatattcacaagaagtgg ataccagaactaaggcattatgctccaaatgtgccgattgtgttagttggaacgaagctt gacttgcgtgaggacaagcagttcttcttggaccaccctggtttagctcctatcactact gcacagggtgaggagctgaaaaggatgataggcgcagctgcgtacatagaatgcagctcc aagacgcaacagaatgtgaaggccgtatttgactcagcgataaaggtcgtgctgtgcccg cccaaaccaaagaagaagagcgcccggaagcagaggagttgctggatcctatga

DBGET integrated database retrieval system