Prionailurus viverrinus (fishing cat): 125146878 Help Entry 125146878         CDS       T09889                                  Name (RefSeq) histone H2AX   KO K11251   histone H2A Organism pviv  Prionailurus viverrinus (fishing cat) Pathway pviv03082   ATP-dependent chromatin remodeling pviv04217   Necroptosis pviv04613   Neutrophil extracellular trap formation pviv05034   Alcoholism pviv05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:pviv00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     125146878  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     125146878  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     125146878  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     125146878   09165 Substance dependence    05034 Alcoholism     125146878  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pviv03036]     125146878   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pviv04147]     125146878 Chromosome and associated proteins [BR:pviv03036]  Eukaryotic type   Nucleosome assembly factors    Histones     125146878 Exosome [BR:pviv04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    125146878 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  125146878 NCBI-ProteinID:  XP_047679752 LinkDB All DBs Position D1:complement(16738252..16739579) Genome browser AA seq 143 aa AA seqDB search MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK TSATVGPKAPAGGKKATQASQEY NT seq 432 nt NT seq  +upstreamnt  +downstreamnt atgtcgggccgtggcaagacgggcggcaaggcccgagccaaggccaaatcgcgctcgtcg cgcgccggcctccagtttccagtgggccgcgtgcaccggctgctgcggaagggccactac gccgaacgggttggcgccggcgcccctgtgtacctggcggccgtgctggagtacctcacc gcggagatcctggagctggcgggcaacgcggcccgcgacaacaagaagacgcggatcatc ccccgccacctgcagctggccatccgcaacgacgaggagctcaacaagctgctgggcggc gtgacgatcgcccagggaggcgtcctgcccaacatccaggccgtgctgctgcccaagaaa accagcgccaccgtggggccgaaggcgccggcgggcggcaagaaggccacccaggcctct caggagtactga

DBGET integrated database retrieval system