Prionailurus viverrinus (fishing cat): 125147112 Help Entry 125147112         CDS       T09889                                  Symbol CFL1 Name (RefSeq) cofilin-1   KO K05765   cofilin Organism pviv  Prionailurus viverrinus (fishing cat) Pathway pviv04360   Axon guidance pviv04666   Fc gamma R-mediated phagocytosis pviv04810   Regulation of actin cytoskeleton pviv05133   Pertussis pviv05170   Human immunodeficiency virus 1 infection Brite KEGG Orthology (KO) [BR:pviv00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     125147112 (CFL1)  09150 Organismal Systems   09151 Immune system    04666 Fc gamma R-mediated phagocytosis     125147112 (CFL1)   09158 Development and regeneration    04360 Axon guidance     125147112 (CFL1)  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     125147112 (CFL1)   09171 Infectious disease: bacterial    05133 Pertussis     125147112 (CFL1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pviv04131]     125147112 (CFL1)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:pviv04812]     125147112 (CFL1)    04147 Exosome [BR:pviv04147]     125147112 (CFL1) Membrane trafficking [BR:pviv04131]  Others   Actin-binding proteins    Others     125147112 (CFL1) Cytoskeleton proteins [BR:pviv04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     ADF / Cofilin      125147112 (CFL1) Exosome [BR:pviv04147]  Exosomal proteins   Proteins found in most exosomes    125147112 (CFL1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cofilin_ADF Motif Other DBs NCBI-GeneID:  125147112 NCBI-ProteinID:  XP_047680078 LinkDB All DBs Position D1:107477414..107481025 Genome browser AA seq 166 aa AA seqDB search MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDV GQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPECAPLKSKMIYASS KDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL NT seq 501 nt NT seq  +upstreamnt  +downstreamnt atggcctctggtgtggcagtctctgatggtgtcatcaaagtgttcaatgacatgaaggtt cgtaagtcctcaacaccagaggaggtgaagaagcgcaagaaggcggtactcttctgcctg agtgaggacaagaagaacatcatcctggaggagggcaaggagatcctggtgggtgatgtg ggccagactgtagacgacccctacgccacctttgtcaagatgctgccagacaaggactgc cgctatgccctctatgatgccacctacgagaccaaggagagcaagaaggaggacctggtg tttatcttctgggcacctgaatgtgcacccctcaagagcaaaatgatttatgccagctcc aaggacgccatcaagaagaagctgacggggatcaagcatgaattacaagcaaactgctac gaggaggtcaaggaccgctgcaccctggccgagaaactggggggcagcgccgtcatctcc ctggagggcaagcctttgtga

DBGET integrated database retrieval system