Prionailurus viverrinus (fishing cat): 125149054 Help Entry 125149054         CDS       T09889                                  Symbol RAB7A Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism pviv  Prionailurus viverrinus (fishing cat) Pathway pviv04137   Mitophagy - animal pviv04140   Autophagy - animal pviv04144   Endocytosis pviv04145   Phagosome pviv04148   Efferocytosis pviv05132   Salmonella infection pviv05146   Amoebiasis pviv05152   Tuberculosis Brite KEGG Orthology (KO) [BR:pviv00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     125149054 (RAB7A)    04145 Phagosome     125149054 (RAB7A)    04140 Autophagy - animal     125149054 (RAB7A)    04137 Mitophagy - animal     125149054 (RAB7A)    04148 Efferocytosis     125149054 (RAB7A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     125149054 (RAB7A)    05152 Tuberculosis     125149054 (RAB7A)   09174 Infectious disease: parasitic    05146 Amoebiasis     125149054 (RAB7A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pviv04131]     125149054 (RAB7A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pviv04147]     125149054 (RAB7A)    04031 GTP-binding proteins [BR:pviv04031]     125149054 (RAB7A) Membrane trafficking [BR:pviv04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     125149054 (RAB7A) Exosome [BR:pviv04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    125149054 (RAB7A)   Exosomal proteins of other body fluids (saliva and urine)    125149054 (RAB7A)   Exosomal proteins of colorectal cancer cells    125149054 (RAB7A)   Exosomal proteins of bladder cancer cells    125149054 (RAB7A) GTP-binding proteins [BR:pviv04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     125149054 (RAB7A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase Gtr1_RagA ATP_bind_1 cobW nSTAND3 PduV-EutP Septin AAA_7 NTPase_1 AAA_22 AAA_16 AAA_24 G-alpha AAA_5 ATPase_2 NACHT AAA_14 NB-ARC SRPRB ATP-synt_ab ABC_tran Motif Other DBs NCBI-GeneID:  125149054 NCBI-ProteinID:  XP_047683572 LinkDB All DBs Position A2:complement(56641779..56712818) Genome browser AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVATKRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDKNDRAKASAESCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacctctaggaagaaagtgttgctgaaggttatcatcctgggagattctggagttggt aagacatcactcatgaaccagtatgtgaacaagaaattcagtaatcagtacaaagctaca ataggagcagactttctgacaaaggaggtgatggtggatgacagactagttacaatgcag atctgggacacagcaggacaggaacggttccagtccctcggtgtggccttctacagaggc gcagactgctgcgttctggtatttgacgtcactgcccccaacacattcaaaacccttgat agctggagagatgagtttctcatccaggccagtccccgggatcctgaaaacttccccttc gtggtgttgggaaacaagattgacctcgaaaacagacaagtggccacaaagcgggcacag gcctggtgctacagcaaaaacaacattccctacttcgagaccagtgccaaggaggccatc aacgtggagcaggcgttccagacgattgcacggaatgcacttaaacaggaaacagaggtg gagctgtacaacgaattccccgaacccatcaaactggacaagaacgaccgggccaaggcc tcggcggaaagctgcagttgctga

DBGET integrated database retrieval system