KEGG   Prionailurus viverrinus (fishing cat): 125149069
Entry
125149069         CDS       T09889                                 
Symbol
MAPK1
Name
(RefSeq) mitogen-activated protein kinase 1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
pviv  Prionailurus viverrinus (fishing cat)
Pathway
pviv01521  EGFR tyrosine kinase inhibitor resistance
pviv01522  Endocrine resistance
pviv01524  Platinum drug resistance
pviv04010  MAPK signaling pathway
pviv04012  ErbB signaling pathway
pviv04014  Ras signaling pathway
pviv04015  Rap1 signaling pathway
pviv04022  cGMP-PKG signaling pathway
pviv04024  cAMP signaling pathway
pviv04062  Chemokine signaling pathway
pviv04066  HIF-1 signaling pathway
pviv04068  FoxO signaling pathway
pviv04071  Sphingolipid signaling pathway
pviv04072  Phospholipase D signaling pathway
pviv04114  Oocyte meiosis
pviv04140  Autophagy - animal
pviv04148  Efferocytosis
pviv04150  mTOR signaling pathway
pviv04151  PI3K-Akt signaling pathway
pviv04210  Apoptosis
pviv04218  Cellular senescence
pviv04261  Adrenergic signaling in cardiomyocytes
pviv04270  Vascular smooth muscle contraction
pviv04350  TGF-beta signaling pathway
pviv04360  Axon guidance
pviv04370  VEGF signaling pathway
pviv04371  Apelin signaling pathway
pviv04380  Osteoclast differentiation
pviv04510  Focal adhesion
pviv04517  IgSF CAM signaling
pviv04520  Adherens junction
pviv04540  Gap junction
pviv04550  Signaling pathways regulating pluripotency of stem cells
pviv04611  Platelet activation
pviv04613  Neutrophil extracellular trap formation
pviv04620  Toll-like receptor signaling pathway
pviv04621  NOD-like receptor signaling pathway
pviv04625  C-type lectin receptor signaling pathway
pviv04650  Natural killer cell mediated cytotoxicity
pviv04657  IL-17 signaling pathway
pviv04658  Th1 and Th2 cell differentiation
pviv04659  Th17 cell differentiation
pviv04660  T cell receptor signaling pathway
pviv04662  B cell receptor signaling pathway
pviv04664  Fc epsilon RI signaling pathway
pviv04666  Fc gamma R-mediated phagocytosis
pviv04668  TNF signaling pathway
pviv04713  Circadian entrainment
pviv04720  Long-term potentiation
pviv04722  Neurotrophin signaling pathway
pviv04723  Retrograde endocannabinoid signaling
pviv04724  Glutamatergic synapse
pviv04725  Cholinergic synapse
pviv04726  Serotonergic synapse
pviv04730  Long-term depression
pviv04810  Regulation of actin cytoskeleton
pviv04910  Insulin signaling pathway
pviv04912  GnRH signaling pathway
pviv04914  Progesterone-mediated oocyte maturation
pviv04915  Estrogen signaling pathway
pviv04916  Melanogenesis
pviv04917  Prolactin signaling pathway
pviv04919  Thyroid hormone signaling pathway
pviv04921  Oxytocin signaling pathway
pviv04926  Relaxin signaling pathway
pviv04928  Parathyroid hormone synthesis, secretion and action
pviv04929  GnRH secretion
pviv04930  Type II diabetes mellitus
pviv04933  AGE-RAGE signaling pathway in diabetic complications
pviv04934  Cushing syndrome
pviv04935  Growth hormone synthesis, secretion and action
pviv04960  Aldosterone-regulated sodium reabsorption
pviv05010  Alzheimer disease
pviv05020  Prion disease
pviv05022  Pathways of neurodegeneration - multiple diseases
pviv05034  Alcoholism
pviv05132  Salmonella infection
pviv05133  Pertussis
pviv05135  Yersinia infection
pviv05140  Leishmaniasis
pviv05142  Chagas disease
pviv05145  Toxoplasmosis
pviv05152  Tuberculosis
pviv05160  Hepatitis C
pviv05161  Hepatitis B
pviv05163  Human cytomegalovirus infection
pviv05164  Influenza A
pviv05165  Human papillomavirus infection
pviv05166  Human T-cell leukemia virus 1 infection
pviv05167  Kaposi sarcoma-associated herpesvirus infection
pviv05170  Human immunodeficiency virus 1 infection
pviv05171  Coronavirus disease - COVID-19
pviv05200  Pathways in cancer
pviv05203  Viral carcinogenesis
pviv05205  Proteoglycans in cancer
pviv05206  MicroRNAs in cancer
pviv05207  Chemical carcinogenesis - receptor activation
pviv05208  Chemical carcinogenesis - reactive oxygen species
pviv05210  Colorectal cancer
pviv05211  Renal cell carcinoma
pviv05212  Pancreatic cancer
pviv05213  Endometrial cancer
pviv05214  Glioma
pviv05215  Prostate cancer
pviv05216  Thyroid cancer
pviv05218  Melanoma
pviv05219  Bladder cancer
pviv05220  Chronic myeloid leukemia
pviv05221  Acute myeloid leukemia
pviv05223  Non-small cell lung cancer
pviv05224  Breast cancer
pviv05225  Hepatocellular carcinoma
pviv05226  Gastric cancer
pviv05230  Central carbon metabolism in cancer
pviv05231  Choline metabolism in cancer
pviv05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pviv05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pviv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    125149069 (MAPK1)
   04012 ErbB signaling pathway
    125149069 (MAPK1)
   04014 Ras signaling pathway
    125149069 (MAPK1)
   04015 Rap1 signaling pathway
    125149069 (MAPK1)
   04350 TGF-beta signaling pathway
    125149069 (MAPK1)
   04370 VEGF signaling pathway
    125149069 (MAPK1)
   04371 Apelin signaling pathway
    125149069 (MAPK1)
   04668 TNF signaling pathway
    125149069 (MAPK1)
   04066 HIF-1 signaling pathway
    125149069 (MAPK1)
   04068 FoxO signaling pathway
    125149069 (MAPK1)
   04072 Phospholipase D signaling pathway
    125149069 (MAPK1)
   04071 Sphingolipid signaling pathway
    125149069 (MAPK1)
   04024 cAMP signaling pathway
    125149069 (MAPK1)
   04022 cGMP-PKG signaling pathway
    125149069 (MAPK1)
   04151 PI3K-Akt signaling pathway
    125149069 (MAPK1)
   04150 mTOR signaling pathway
    125149069 (MAPK1)
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    125149069 (MAPK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    125149069 (MAPK1)
   04148 Efferocytosis
    125149069 (MAPK1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    125149069 (MAPK1)
   04210 Apoptosis
    125149069 (MAPK1)
   04218 Cellular senescence
    125149069 (MAPK1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    125149069 (MAPK1)
   04520 Adherens junction
    125149069 (MAPK1)
   04540 Gap junction
    125149069 (MAPK1)
   04550 Signaling pathways regulating pluripotency of stem cells
    125149069 (MAPK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    125149069 (MAPK1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    125149069 (MAPK1)
   04613 Neutrophil extracellular trap formation
    125149069 (MAPK1)
   04620 Toll-like receptor signaling pathway
    125149069 (MAPK1)
   04621 NOD-like receptor signaling pathway
    125149069 (MAPK1)
   04625 C-type lectin receptor signaling pathway
    125149069 (MAPK1)
   04650 Natural killer cell mediated cytotoxicity
    125149069 (MAPK1)
   04660 T cell receptor signaling pathway
    125149069 (MAPK1)
   04658 Th1 and Th2 cell differentiation
    125149069 (MAPK1)
   04659 Th17 cell differentiation
    125149069 (MAPK1)
   04657 IL-17 signaling pathway
    125149069 (MAPK1)
   04662 B cell receptor signaling pathway
    125149069 (MAPK1)
   04664 Fc epsilon RI signaling pathway
    125149069 (MAPK1)
   04666 Fc gamma R-mediated phagocytosis
    125149069 (MAPK1)
   04062 Chemokine signaling pathway
    125149069 (MAPK1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    125149069 (MAPK1)
   04929 GnRH secretion
    125149069 (MAPK1)
   04912 GnRH signaling pathway
    125149069 (MAPK1)
   04915 Estrogen signaling pathway
    125149069 (MAPK1)
   04914 Progesterone-mediated oocyte maturation
    125149069 (MAPK1)
   04917 Prolactin signaling pathway
    125149069 (MAPK1)
   04921 Oxytocin signaling pathway
    125149069 (MAPK1)
   04926 Relaxin signaling pathway
    125149069 (MAPK1)
   04935 Growth hormone synthesis, secretion and action
    125149069 (MAPK1)
   04919 Thyroid hormone signaling pathway
    125149069 (MAPK1)
   04928 Parathyroid hormone synthesis, secretion and action
    125149069 (MAPK1)
   04916 Melanogenesis
    125149069 (MAPK1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    125149069 (MAPK1)
   04270 Vascular smooth muscle contraction
    125149069 (MAPK1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    125149069 (MAPK1)
  09156 Nervous system
   04724 Glutamatergic synapse
    125149069 (MAPK1)
   04725 Cholinergic synapse
    125149069 (MAPK1)
   04726 Serotonergic synapse
    125149069 (MAPK1)
   04720 Long-term potentiation
    125149069 (MAPK1)
   04730 Long-term depression
    125149069 (MAPK1)
   04723 Retrograde endocannabinoid signaling
    125149069 (MAPK1)
   04722 Neurotrophin signaling pathway
    125149069 (MAPK1)
  09158 Development and regeneration
   04360 Axon guidance
    125149069 (MAPK1)
   04380 Osteoclast differentiation
    125149069 (MAPK1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    125149069 (MAPK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    125149069 (MAPK1)
   05206 MicroRNAs in cancer
    125149069 (MAPK1)
   05205 Proteoglycans in cancer
    125149069 (MAPK1)
   05207 Chemical carcinogenesis - receptor activation
    125149069 (MAPK1)
   05208 Chemical carcinogenesis - reactive oxygen species
    125149069 (MAPK1)
   05203 Viral carcinogenesis
    125149069 (MAPK1)
   05230 Central carbon metabolism in cancer
    125149069 (MAPK1)
   05231 Choline metabolism in cancer
    125149069 (MAPK1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    125149069 (MAPK1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    125149069 (MAPK1)
   05212 Pancreatic cancer
    125149069 (MAPK1)
   05225 Hepatocellular carcinoma
    125149069 (MAPK1)
   05226 Gastric cancer
    125149069 (MAPK1)
   05214 Glioma
    125149069 (MAPK1)
   05216 Thyroid cancer
    125149069 (MAPK1)
   05221 Acute myeloid leukemia
    125149069 (MAPK1)
   05220 Chronic myeloid leukemia
    125149069 (MAPK1)
   05218 Melanoma
    125149069 (MAPK1)
   05211 Renal cell carcinoma
    125149069 (MAPK1)
   05219 Bladder cancer
    125149069 (MAPK1)
   05215 Prostate cancer
    125149069 (MAPK1)
   05213 Endometrial cancer
    125149069 (MAPK1)
   05224 Breast cancer
    125149069 (MAPK1)
   05223 Non-small cell lung cancer
    125149069 (MAPK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    125149069 (MAPK1)
   05170 Human immunodeficiency virus 1 infection
    125149069 (MAPK1)
   05161 Hepatitis B
    125149069 (MAPK1)
   05160 Hepatitis C
    125149069 (MAPK1)
   05171 Coronavirus disease - COVID-19
    125149069 (MAPK1)
   05164 Influenza A
    125149069 (MAPK1)
   05163 Human cytomegalovirus infection
    125149069 (MAPK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    125149069 (MAPK1)
   05165 Human papillomavirus infection
    125149069 (MAPK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    125149069 (MAPK1)
   05135 Yersinia infection
    125149069 (MAPK1)
   05133 Pertussis
    125149069 (MAPK1)
   05152 Tuberculosis
    125149069 (MAPK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    125149069 (MAPK1)
   05140 Leishmaniasis
    125149069 (MAPK1)
   05142 Chagas disease
    125149069 (MAPK1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    125149069 (MAPK1)
   05020 Prion disease
    125149069 (MAPK1)
   05022 Pathways of neurodegeneration - multiple diseases
    125149069 (MAPK1)
  09165 Substance dependence
   05034 Alcoholism
    125149069 (MAPK1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    125149069 (MAPK1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    125149069 (MAPK1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    125149069 (MAPK1)
   04934 Cushing syndrome
    125149069 (MAPK1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    125149069 (MAPK1)
   01524 Platinum drug resistance
    125149069 (MAPK1)
   01522 Endocrine resistance
    125149069 (MAPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pviv01001]
    125149069 (MAPK1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pviv03036]
    125149069 (MAPK1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pviv04147]
    125149069 (MAPK1)
Enzymes [BR:pviv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     125149069 (MAPK1)
Protein kinases [BR:pviv01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   125149069 (MAPK1)
Chromosome and associated proteins [BR:pviv03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     125149069 (MAPK1)
Exosome [BR:pviv04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   125149069 (MAPK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH STATB_N Haspin_kinase FTA2 Kdo
Other DBs
NCBI-GeneID: 125149069
NCBI-ProteinID: XP_047683606
LinkDB
Position
D3:complement(30929297..31040265)
AA seq 362 aa
MAAAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISP
FEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKT
QHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDH
DHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLN
HILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNP
HKRIEVEQALAHPYLEQYYDPSDEPVAEAPFKFDMELDDLPKEKLKELIFEETARFQPGY
RS
NT seq 1089 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggcggcggcggcgggcgcgggcccggagatggtccgcgggcaggtg
ttcgacgtggggccgcgctacaccaacctctcgtatatcggcgagggcgcctacggcatg
gtgtgctctgcttatgataatgtcaacaaagttcgagtagctatcaagaaaatcagtcct
tttgagcaccagacctactgccagagaaccctgagggagataaaaatcttactgcgcttc
agacatgagaacatcattggaatcaatgatattattagagcaccaaccatcgagcaaatg
aaagatgtatatatagtacaggacctcatggaaacagatctctacaagctcttgaagaca
caacacctcagcaacgaccatatctgctattttctttaccagatcctcagagggttaaaa
tatatccattcagctaatgtactgcaccgtgacctcaaaccttccaacctgctgctcaac
accacctgtgatctcaagatctgtgactttggcttggcccgcgttgcagatccagaccat
gatcacacagggttcctgacggagtacgtagccacacgttggtaccgggctccagaaatt
atgttgaattccaagggctataccaagtccattgatatttggtctgtaggctgcattctg
gcagagatgctgtccaacaggcccatcttcccggggaagcattatctcgaccagctgaac
cacattctgggtattcttggatccccatcacaggaagacctgaattgtataataaattta
aaagctagaaactacttgctttctcttccacacaaaaataaggtgccatggaacaggctg
ttcccaaatgctgattccaaagctctggatttactggacaaaatgttgacgttcaaccct
cacaagaggattgaagtagaacaggctctggcccatccatatctggagcagtattacgac
ccaagtgatgagcccgtcgctgaggcaccgttcaagttcgacatggagctagacgacctg
cccaaggaaaagctcaaagagctcatcttcgaagagacggccaggttccagcccggatac
aggtcttaa

DBGET integrated database retrieval system