Prionailurus viverrinus (fishing cat): 125150082 Help Entry 125150082         CDS       T09889                                  Symbol CCL27 Name (RefSeq) C-C motif chemokine 27   KO K16598   C-C motif chemokine 27 Organism pviv  Prionailurus viverrinus (fishing cat) Pathway pviv04060   Cytokine-cytokine receptor interaction pviv04061   Viral protein interaction with cytokine and cytokine receptor pviv04062   Chemokine signaling pathway Brite KEGG Orthology (KO) [BR:pviv00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     125150082 (CCL27)    04061 Viral protein interaction with cytokine and cytokine receptor     125150082 (CCL27)  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     125150082 (CCL27)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pviv04052]     125150082 (CCL27) Cytokines and neuropeptides [BR:pviv04052]  Cytokines   Chemokines    125150082 (CCL27) SSDB OrthologParalogGFIT Motif Pfam:  IL8 VMAP-M1 Motif Other DBs NCBI-GeneID:  125150082 NCBI-ProteinID:  XP_047685383 LinkDB All DBs Position D4:31425710..31427408 Genome browser AA seq 115 aa AA seqDB search MKGPSPTSSLLLLLLLLTPDPGAALLLSPSITCCTQLYRQPLSNKLLRKVIRVELQEADG DCHLQAFVLHLSRRSVCIHPQNRSLARWFERQGRRFQGILPNLNLELIGKMDQGP NT seq 348 nt NT seq  +upstreamnt  +downstreamnt atgaaggggccctcacccacaagcagcctccttctgctactgctgctgctgaccccagac cctggagcagcactgctactgtcacccagcattacctgctgtactcagctctaccgccag ccactctcgaacaagctactaaggaaagtcatccgggtggaactgcaggaagctgatggg gactgtcacctccaggccttcgtgcttcacttgtctcgacgcagtgtctgcatccatcct cagaaccgcagcctggctcggtggtttgagcgccaagggaggagattccagggtattctg cctaacctgaatttggagctgatagggaaaatggaccaggggccctaa

DBGET integrated database retrieval system