Prionailurus viverrinus (fishing cat): 125150161 Help Entry 125150161         CDS       T09889                                  Symbol PPP3R2 Name (RefSeq) calcineurin subunit B type 2   KO K06268   serine/threonine-protein phosphatase 2B regulatory subunit Organism pviv  Prionailurus viverrinus (fishing cat) Pathway pviv04010   MAPK signaling pathway pviv04020   Calcium signaling pathway pviv04022   cGMP-PKG signaling pathway pviv04114   Oocyte meiosis pviv04218   Cellular senescence pviv04310   Wnt signaling pathway pviv04360   Axon guidance pviv04370   VEGF signaling pathway pviv04380   Osteoclast differentiation pviv04625   C-type lectin receptor signaling pathway pviv04650   Natural killer cell mediated cytotoxicity pviv04658   Th1 and Th2 cell differentiation pviv04659   Th17 cell differentiation pviv04660   T cell receptor signaling pathway pviv04662   B cell receptor signaling pathway pviv04720   Long-term potentiation pviv04724   Glutamatergic synapse pviv04921   Oxytocin signaling pathway pviv04922   Glucagon signaling pathway pviv04924   Renin secretion pviv05010   Alzheimer disease pviv05014   Amyotrophic lateral sclerosis pviv05020   Prion disease pviv05022   Pathways of neurodegeneration - multiple diseases pviv05031   Amphetamine addiction pviv05152   Tuberculosis pviv05163   Human cytomegalovirus infection pviv05166   Human T-cell leukemia virus 1 infection pviv05167   Kaposi sarcoma-associated herpesvirus infection pviv05170   Human immunodeficiency virus 1 infection pviv05235   PD-L1 expression and PD-1 checkpoint pathway in cancer pviv05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:pviv00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     125150161 (PPP3R2)    04310 Wnt signaling pathway     125150161 (PPP3R2)    04370 VEGF signaling pathway     125150161 (PPP3R2)    04020 Calcium signaling pathway     125150161 (PPP3R2)    04022 cGMP-PKG signaling pathway     125150161 (PPP3R2)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     125150161 (PPP3R2)    04218 Cellular senescence     125150161 (PPP3R2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     125150161 (PPP3R2)    04650 Natural killer cell mediated cytotoxicity     125150161 (PPP3R2)    04660 T cell receptor signaling pathway     125150161 (PPP3R2)    04658 Th1 and Th2 cell differentiation     125150161 (PPP3R2)    04659 Th17 cell differentiation     125150161 (PPP3R2)    04662 B cell receptor signaling pathway     125150161 (PPP3R2)   09152 Endocrine system    04922 Glucagon signaling pathway     125150161 (PPP3R2)    04921 Oxytocin signaling pathway     125150161 (PPP3R2)    04924 Renin secretion     125150161 (PPP3R2)   09156 Nervous system    04724 Glutamatergic synapse     125150161 (PPP3R2)    04720 Long-term potentiation     125150161 (PPP3R2)   09158 Development and regeneration    04360 Axon guidance     125150161 (PPP3R2)    04380 Osteoclast differentiation     125150161 (PPP3R2)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     125150161 (PPP3R2)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     125150161 (PPP3R2)    05170 Human immunodeficiency virus 1 infection     125150161 (PPP3R2)    05163 Human cytomegalovirus infection     125150161 (PPP3R2)    05167 Kaposi sarcoma-associated herpesvirus infection     125150161 (PPP3R2)   09171 Infectious disease: bacterial    05152 Tuberculosis     125150161 (PPP3R2)   09164 Neurodegenerative disease    05010 Alzheimer disease     125150161 (PPP3R2)    05014 Amyotrophic lateral sclerosis     125150161 (PPP3R2)    05020 Prion disease     125150161 (PPP3R2)    05022 Pathways of neurodegeneration - multiple diseases     125150161 (PPP3R2)   09165 Substance dependence    05031 Amphetamine addiction     125150161 (PPP3R2)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     125150161 (PPP3R2)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:pviv01009]     125150161 (PPP3R2) Protein phosphatases and associated proteins [BR:pviv01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      125150161 (PPP3R2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 EF-hand_4 SPARC_Ca_bdg EF-hand_9 YtfJ_HI0045 flgK_1st_1 Motif Other DBs NCBI-GeneID:  125150161 NCBI-ProteinID:  XP_047685566 LinkDB All DBs Position D4:24315335..24316476 Genome browser AA seq 170 aa AA seqDB search MGNEASYPTEMCSHFNHDEIKRLSKRFKKLDLDCSGSLSVDEFLSLPELRQNPLVQRVID VFDTDGNGEVDFEEFVVGTSQFSVRGDEEQKLRFAFSIYDMDKDGYISNGELFQVLKMMV GNNLQDWQLQQIVDKTIIILDRDGDGRISFEEFSAVVGNLEVHKKLVVIV NT seq 513 nt NT seq  +upstreamnt  +downstreamnt atgggaaatgaagctagttacccgacggagatgtgctcccacttcaaccacgatgaaatt aaaaggctgagcaagagatttaagaagctggacttggactgttcgggctctctgagcgtg gacgagttcttgtccctgcccgagctgcggcagaacccgttggtgcagcgagtgatcgac gtcttcgacaccgacggcaatggagaggtggactttgaggagttcgtcgtggggacctcc cagttcagcgtcaggggggacgaggagcagaagttgaggtttgccttcagcatctatgac atggataaagacggctacatttccaacggggagctgttccaggtgctgaagatgatggtg gggaacaacctgcaagactggcagttacagcagatcgtggacaaaaccatcatcatcctg gacagggatggcgacgggagaatatccttcgaggaattcagtgcggtggtcggaaacctg gaggtccacaagaagttggtggtaattgtgtga

DBGET integrated database retrieval system