Prionailurus viverrinus (fishing cat): 125150820 Help Entry 125150820         CDS       T09889                                  Name (RefSeq) interferon alpha-2-like   KO K05414   interferon alpha Organism pviv  Prionailurus viverrinus (fishing cat) Pathway pviv04060   Cytokine-cytokine receptor interaction pviv04151   PI3K-Akt signaling pathway pviv04217   Necroptosis pviv04620   Toll-like receptor signaling pathway pviv04621   NOD-like receptor signaling pathway pviv04622   RIG-I-like receptor signaling pathway pviv04623   Cytosolic DNA-sensing pathway pviv04630   JAK-STAT signaling pathway pviv04650   Natural killer cell mediated cytotoxicity pviv04936   Alcoholic liver disease pviv05152   Tuberculosis pviv05160   Hepatitis C pviv05161   Hepatitis B pviv05162   Measles pviv05163   Human cytomegalovirus infection pviv05164   Influenza A pviv05165   Human papillomavirus infection pviv05167   Kaposi sarcoma-associated herpesvirus infection pviv05168   Herpes simplex virus 1 infection pviv05169   Epstein-Barr virus infection pviv05170   Human immunodeficiency virus 1 infection pviv05171   Coronavirus disease - COVID-19 pviv05200   Pathways in cancer pviv05320   Autoimmune thyroid disease pviv05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:pviv00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     125150820    04151 PI3K-Akt signaling pathway     125150820   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     125150820  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     125150820  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     125150820    04621 NOD-like receptor signaling pathway     125150820    04622 RIG-I-like receptor signaling pathway     125150820    04623 Cytosolic DNA-sensing pathway     125150820    04650 Natural killer cell mediated cytotoxicity     125150820  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     125150820   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     125150820    05161 Hepatitis B     125150820    05160 Hepatitis C     125150820    05171 Coronavirus disease - COVID-19     125150820    05164 Influenza A     125150820    05162 Measles     125150820    05168 Herpes simplex virus 1 infection     125150820    05163 Human cytomegalovirus infection     125150820    05167 Kaposi sarcoma-associated herpesvirus infection     125150820    05169 Epstein-Barr virus infection     125150820    05165 Human papillomavirus infection     125150820   09171 Infectious disease: bacterial    05152 Tuberculosis     125150820   09163 Immune disease    05320 Autoimmune thyroid disease     125150820   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     125150820   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     125150820  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pviv04052]     125150820 Cytokines and neuropeptides [BR:pviv04052]  Cytokines   Interferons    125150820 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon MRB1590_C Motif Other DBs NCBI-GeneID:  125150820 NCBI-ProteinID:  XP_047687162 LinkDB All DBs Position D4:42392125..42392703 Genome browser AA seq 192 aa AA seqDB search MTSRSFPSWALMLLLSSTACSLDCHFQRRGIWEIVQHLENLGGKFPLRCLKDRSNFRFLQ VAKIDQLLEETAFPAIGEMLRQVFNTFSLNVSQSLWNESRLERLLSGLYQQTEKTGVCLE QDSGQEDHSSSQREGTRLAIKNYFQGIRDYLQGPKYSHCAWEVIRVEIRRCFLFIEQLTR RHRDQEIGHLHN NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atgaccagccggagcttcccgagctgggctttgatgctacttctttccagtactgcctgc tctctggactgtcactttcaacggaggggcatctgggagattgtacaacatttagagaac cttggaggaaaatttcccctgagatgtctgaaggacagaagcaacttcagattcctccag gttgcaaaaatcgaccagcttctggaggaaactgctttcccggccattggagaaatgctg cgacaggtcttcaacactttcagcctgaatgtctcccaatcattgtggaatgaaagccgt ttagagagactcctaagtggactgtatcagcaaacggagaagacaggggtatgcctggag caggactctgggcaggaggatcattcatcctcgcaaagggagggtaccagacttgcaata aagaattatttccaaggcatccgtgactatttgcaaggcccaaagtatagccactgtgcc tgggaggtcatccgtgtggaaatccgaaggtgttttctcttcattgaacagctgacaaga agacatcgggaccaagaaataggtcacttacataactaa

DBGET integrated database retrieval system