Prionailurus viverrinus (fishing cat): 125151709 Help Entry 125151709         CDS       T09889                                  Name (RefSeq) histone H3.3A   KO K11253   histone H3 Organism pviv  Prionailurus viverrinus (fishing cat) Pathway pviv04613   Neutrophil extracellular trap formation pviv05034   Alcoholism pviv05202   Transcriptional misregulation in cancer pviv05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:pviv00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     125151709  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     125151709   09163 Immune disease    05322 Systemic lupus erythematosus     125151709   09165 Substance dependence    05034 Alcoholism     125151709  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pviv03036]     125151709   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pviv04147]     125151709 Chromosome and associated proteins [BR:pviv03036]  Eukaryotic type   Nucleosome assembly factors    Histones     125151709 Exosome [BR:pviv04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    125151709 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF TFIID-31kDa Motif Other DBs NCBI-GeneID:  125151709 NCBI-ProteinID:  XP_047689054 LinkDB All DBs Position E1:complement(47611710..47615100) Genome browser AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggcccgaaccaagcagactgctcgtaaatctacgggtgggaaagcgccccgtaagcag ctggccactaaagccgccaggaaaagtgctccctctactggcggggtgaaaaaacctcat cgctacaggcccgggaccgttgcgcttcgagagatccgtcgttaccagaaatcgaccgag cttctgatccggaagctgcctttccagaggttggtgagggagatcgcccaggatttcaaa accgatctgaggtttcagagtgccgccattggtgcgctgcaggaggccagtgaagcgtac ctggtgggtttatttgaagatactaatctgtgtgccatccacgctaagagagtcaccatc atgcccaaagacatccagttggctcgccggatacggggagagagagcttaa

DBGET integrated database retrieval system