Prionailurus viverrinus (fishing cat): 125152170 Help Entry 125152170         CDS       T09889                                  Name (RefSeq) C-C motif chemokine 3   KO K05408   C-C motif chemokine 3 Organism pviv  Prionailurus viverrinus (fishing cat) Pathway pviv04060   Cytokine-cytokine receptor interaction pviv04061   Viral protein interaction with cytokine and cytokine receptor pviv04062   Chemokine signaling pathway pviv04620   Toll-like receptor signaling pathway pviv05142   Chagas disease pviv05163   Human cytomegalovirus infection pviv05323   Rheumatoid arthritis pviv05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:pviv00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     125152170    04061 Viral protein interaction with cytokine and cytokine receptor     125152170  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     125152170    04062 Chemokine signaling pathway     125152170  09160 Human Diseases   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     125152170   09174 Infectious disease: parasitic    05142 Chagas disease     125152170   09163 Immune disease    05323 Rheumatoid arthritis     125152170   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     125152170  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pviv04052]     125152170    00536 Glycosaminoglycan binding proteins [BR:pviv00536]     125152170 Cytokines and neuropeptides [BR:pviv04052]  Cytokines   Chemokines    125152170 Glycosaminoglycan binding proteins [BR:pviv00536]  Heparan sulfate / Heparin   Chemokines    125152170 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  125152170 NCBI-ProteinID:  XP_047689967 LinkDB All DBs Position E1:complement(23173560..23175453) Genome browser AA seq 93 aa AA seqDB search MKVPGASLAILLCTMALCSQVFSAPFGADTPTACCFSYVSKQIPRKFIADYFETSSQCSK PGVIFQTRRGRQVCADPSEAWVQEYVTDLELSA NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgaaggtccccggggcttccctcgccatcctcctctgcaccatggccctctgcagtcag gtcttctctgcaccatttggagctgacaccccaactgcctgctgcttctcctatgtctcc aagcagattccacgcaagttcatagccgactattttgagaccagcagccaatgctccaag ccaggggttatctttcaaaccagaagaggccggcaggtctgtgctgaccccagtgaagcc tgggtccaggaatatgtgactgacttggagctgagtgcctga

DBGET integrated database retrieval system