Prionailurus viverrinus (fishing cat): 125152172 Help Entry 125152172         CDS       T09889                                  Name (RefSeq) C-C motif chemokine 4   KO K12964   C-C motif chemokine 4 Organism pviv  Prionailurus viverrinus (fishing cat) Pathway pviv04060   Cytokine-cytokine receptor interaction pviv04061   Viral protein interaction with cytokine and cytokine receptor pviv04062   Chemokine signaling pathway pviv04064   NF-kappa B signaling pathway pviv04620   Toll-like receptor signaling pathway pviv04623   Cytosolic DNA-sensing pathway pviv05163   Human cytomegalovirus infection Brite KEGG Orthology (KO) [BR:pviv00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     125152172   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     125152172    04061 Viral protein interaction with cytokine and cytokine receptor     125152172  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     125152172    04623 Cytosolic DNA-sensing pathway     125152172    04062 Chemokine signaling pathway     125152172  09160 Human Diseases   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     125152172  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pviv04052]     125152172 Cytokines and neuropeptides [BR:pviv04052]  Cytokines   Chemokines    125152172 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  125152172 NCBI-ProteinID:  XP_047689970 LinkDB All DBs Position E1:23185206..23187070 Genome browser AA seq 92 aa AA seqDB search MKLCVTVLSLLVLVAAFCSPTLSAPMGSDPPTACCFSYALRKLPRNFVVDYFETSSLCSQ PAVVFQTKRGRQVCANPSDSWVQEYMDDLELN NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaaactctgtgtgactgtcctttctctccttgtgctagtggctgccttctgctccccg acgctctcagcaccaatgggctcagaccctcccaccgcctgctgcttctcttacgccctg cggaagctccctcgaaactttgtagtggattactttgagaccagcagcctctgctcccag ccagctgtggtattccaaaccaaaaggggcagacaagtctgtgctaaccccagtgactcc tgggtccaggaatacatggatgacctggaactgaactga

DBGET integrated database retrieval system