Prionailurus viverrinus (fishing cat): 125158392 Help Entry 125158392         CDS       T09889                                  Symbol GAST Name (RefSeq) gastrin   KO K13768   gastrin Organism pviv  Prionailurus viverrinus (fishing cat) Pathway pviv04081   Hormone signaling pviv04971   Gastric acid secretion Brite KEGG Orthology (KO) [BR:pviv00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04081 Hormone signaling     125158392 (GAST)  09150 Organismal Systems   09154 Digestive system    04971 Gastric acid secretion     125158392 (GAST)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pviv04052]     125158392 (GAST) Cytokines and neuropeptides [BR:pviv04052]  Neuropeptides   GPCR binding    125158392 (GAST) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Gastrin Motif Other DBs NCBI-GeneID:  125158392 NCBI-ProteinID:  XP_047701291 LinkDB All DBs Position Unknown AA seq 104 aa AA seqDB search MQRLCVCVLILALALTAFSEASWKPRSQLQDAPSGPGANRGLEPHWLNRLGPASHHRRQL GLQGPPQLVADLSKKQGPWLEEEEAAYGWMDFGRRSAEDGDQHP NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgcaacgactgtgtgtgtgcgtgctgatcttggcactggctctgactgccttctctgaa gcttcctggaagccccgctcccagctgcaggatgcaccctcgggtccaggggccaacagg ggcctggaaccacattggctgaaccggctgggcccagcctctcaccaccgacggcagcta gggctccagggtcccccacagctggtggcagacctgtccaagaagcagggaccgtggctg gaggaagaagaagcagcatacggatggatggacttcggccgccgcagtgcagaggatggg gaccaacatccctag

DBGET integrated database retrieval system