Prionailurus viverrinus (fishing cat): 125159531 Help Entry 125159531         CDS       T09889                                  Name (RefSeq) histone H2B type 2-F isoform X1   KO K11252   histone H2B Organism pviv  Prionailurus viverrinus (fishing cat) Pathway pviv04613   Neutrophil extracellular trap formation pviv05034   Alcoholism pviv05203   Viral carcinogenesis pviv05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:pviv00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     125159531  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     125159531   09163 Immune disease    05322 Systemic lupus erythematosus     125159531   09165 Substance dependence    05034 Alcoholism     125159531  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pviv03036]     125159531   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pviv04147]     125159531 Chromosome and associated proteins [BR:pviv03036]  Eukaryotic type   Nucleosome assembly factors    Histones     125159531 Exosome [BR:pviv04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    125159531 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like Motif Other DBs NCBI-GeneID:  125159531 NCBI-ProteinID:  XP_047703976 LinkDB All DBs Position Unknown AA seq 138 aa AA seqDB search MPDPAKSAPAPKKGSKKAVTKVQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSSKFVHKTTFWANEG NT seq 417 nt NT seq  +upstreamnt  +downstreamnt atgcctgatccagcgaagtcggctcccgctcccaagaagggctctaagaaagctgttacg aaagtgcagaagaaggacggcaagaagcgcaagcgtagccgtaaggagagctattccgtc tatgtgtataaggtgttgaaacaggttcacccggacaccggcatctcgtccaaggccatg ggcatcatgaactcgttcgtcaacgacatcttcgagcgcatcgccggtgaagcctctcgc ctggcgcattacaacaagcgctcgaccatcacgtcccgggagatccagacggccgtgcgt ctgctgctgcccggcgagctggccaagcatgccgtgtccgagggcaccaaggctgtcacc aaatacaccagctcgaagtttgtccataagacaacgttctgggccaatgaggggtga

DBGET integrated database retrieval system