Prionailurus viverrinus (fishing cat): 125159536 Help Entry 125159536         CDS       T09889                                  Name (RefSeq) histone H2B type 2-E-like   KO K11252   histone H2B Organism pviv  Prionailurus viverrinus (fishing cat) Pathway pviv04613   Neutrophil extracellular trap formation pviv05034   Alcoholism pviv05203   Viral carcinogenesis pviv05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:pviv00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     125159536  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     125159536   09163 Immune disease    05322 Systemic lupus erythematosus     125159536   09165 Substance dependence    05034 Alcoholism     125159536  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pviv03036]     125159536   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pviv04147]     125159536 Chromosome and associated proteins [BR:pviv03036]  Eukaryotic type   Nucleosome assembly factors    Histones     125159536 Exosome [BR:pviv04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    125159536 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa ARM_TT21 Motif Other DBs NCBI-GeneID:  125159536 NCBI-ProteinID:  XP_047703982 LinkDB All DBs Position Unknown AA seq 126 aa AA seqDB search MPEPAKSAPAAKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcccgagccggcaaagtccgcccccgcggccaagaagggctcgaagaaggcggtcacc aaagcccagaagaaggacggcaagaagcgcaagcgcagccgcaaggagagttactccatc tacgtgtacaaggtgctcaagcaggtgcaccccgacaccggcatctcgtccaaggccatg ggcatcatgaactcgttcgtcaacgacatcttcgagcgcatcgccggcgaggcctcccgc ctggcgcattacaacaagcgctcgaccatcacctcccgggagatccagacggccgtgcgc ctgctgctgcccggcgagctggccaagcacgccgtgtccgagggcaccaaggccgtcacc aagtacaccagctccaagtga

DBGET integrated database retrieval system