Prionailurus viverrinus (fishing cat): 125160828 Help Entry 125160828         CDS       T09889                                  Symbol IL5 Name (RefSeq) interleukin-5   KO K05428   interleukin 5 Organism pviv  Prionailurus viverrinus (fishing cat) Pathway pviv04060   Cytokine-cytokine receptor interaction pviv04630   JAK-STAT signaling pathway pviv04640   Hematopoietic cell lineage pviv04657   IL-17 signaling pathway pviv04658   Th1 and Th2 cell differentiation pviv04660   T cell receptor signaling pathway pviv04664   Fc epsilon RI signaling pathway pviv04672   Intestinal immune network for IgA production pviv05200   Pathways in cancer pviv05310   Asthma pviv05320   Autoimmune thyroid disease pviv05321   Inflammatory bowel disease pviv05330   Allograft rejection Brite KEGG Orthology (KO) [BR:pviv00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     125160828 (IL5)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     125160828 (IL5)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     125160828 (IL5)    04660 T cell receptor signaling pathway     125160828 (IL5)    04658 Th1 and Th2 cell differentiation     125160828 (IL5)    04657 IL-17 signaling pathway     125160828 (IL5)    04664 Fc epsilon RI signaling pathway     125160828 (IL5)    04672 Intestinal immune network for IgA production     125160828 (IL5)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     125160828 (IL5)   09163 Immune disease    05310 Asthma     125160828 (IL5)    05320 Autoimmune thyroid disease     125160828 (IL5)    05321 Inflammatory bowel disease     125160828 (IL5)    05330 Allograft rejection     125160828 (IL5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pviv04052]     125160828 (IL5)    00536 Glycosaminoglycan binding proteins [BR:pviv00536]     125160828 (IL5) Cytokines and neuropeptides [BR:pviv04052]  Cytokines   Interleukins    125160828 (IL5) Glycosaminoglycan binding proteins [BR:pviv00536]  Heparan sulfate / Heparin   Cytokines    125160828 (IL5) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL5 Motif Other DBs NCBI-GeneID:  125160828 NCBI-ProteinID:  XP_047706179 LinkDB All DBs Position A1:complement(109993493..109995572) Genome browser AA seq 134 aa AA seqDB search MRMLLHLSLLALGAAYVSAIAVQSPMNRLVAETLALLSTHRTLLIGDGNLMIPTPEHNNH QLCIEEVFQGIDTLKNRTVPGDAVEKLFRNLSLIKEHIDHQKKKCGGERWRVKKFLDYLQ VFLGVINTEWTMES NT seq 405 nt NT seq  +upstreamnt  +downstreamnt atgagaatgcttctgcatttgagtttgctagctcttggggctgcctatgtttctgccatt gctgtacaaagtcccatgaataggctggtggcagagaccttggcactgctctccactcat cgaactctactgataggcgacgggaacctgatgattcctactcctgaacataacaatcac caactgtgcattgaagaagtctttcagggtatagacacattaaagaatcgcactgtaccg ggggatgctgtggaaaagcttttccgaaacttgtctttaataaaagaacacatagaccac caaaaaaaaaagtgtggaggagaaagatggagagtaaaaaagttcctagactacctgcaa gtgtttcttggtgtaataaacactgagtggacaatggaaagttga

DBGET integrated database retrieval system