Prionailurus viverrinus (fishing cat): 125162001 Help Entry 125162001         CDS       T09889                                  Symbol BCL2L1 Name (RefSeq) bcl-2-like protein 1   KO K04570   Bcl-2-like 1 (apoptosis regulator Bcl-X) Organism pviv  Prionailurus viverrinus (fishing cat) Pathway pviv01521   EGFR tyrosine kinase inhibitor resistance pviv01524   Platinum drug resistance pviv04014   Ras signaling pathway pviv04064   NF-kappa B signaling pathway pviv04115   p53 signaling pathway pviv04137   Mitophagy - animal pviv04140   Autophagy - animal pviv04151   PI3K-Akt signaling pathway pviv04210   Apoptosis pviv04215   Apoptosis - multiple species pviv04621   NOD-like receptor signaling pathway pviv04630   JAK-STAT signaling pathway pviv05012   Parkinson disease pviv05014   Amyotrophic lateral sclerosis pviv05022   Pathways of neurodegeneration - multiple diseases pviv05145   Toxoplasmosis pviv05162   Measles pviv05166   Human T-cell leukemia virus 1 infection pviv05168   Herpes simplex virus 1 infection pviv05170   Human immunodeficiency virus 1 infection pviv05200   Pathways in cancer pviv05202   Transcriptional misregulation in cancer pviv05212   Pancreatic cancer pviv05220   Chronic myeloid leukemia pviv05222   Small cell lung cancer pviv05225   Hepatocellular carcinoma pviv05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:pviv00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     125162001 (BCL2L1)    04630 JAK-STAT signaling pathway     125162001 (BCL2L1)    04064 NF-kappa B signaling pathway     125162001 (BCL2L1)    04151 PI3K-Akt signaling pathway     125162001 (BCL2L1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     125162001 (BCL2L1)    04137 Mitophagy - animal     125162001 (BCL2L1)   09143 Cell growth and death    04210 Apoptosis     125162001 (BCL2L1)    04215 Apoptosis - multiple species     125162001 (BCL2L1)    04115 p53 signaling pathway     125162001 (BCL2L1)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     125162001 (BCL2L1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     125162001 (BCL2L1)    05202 Transcriptional misregulation in cancer     125162001 (BCL2L1)   09162 Cancer: specific types    05212 Pancreatic cancer     125162001 (BCL2L1)    05225 Hepatocellular carcinoma     125162001 (BCL2L1)    05220 Chronic myeloid leukemia     125162001 (BCL2L1)    05222 Small cell lung cancer     125162001 (BCL2L1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     125162001 (BCL2L1)    05170 Human immunodeficiency virus 1 infection     125162001 (BCL2L1)    05162 Measles     125162001 (BCL2L1)    05168 Herpes simplex virus 1 infection     125162001 (BCL2L1)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     125162001 (BCL2L1)   09164 Neurodegenerative disease    05012 Parkinson disease     125162001 (BCL2L1)    05014 Amyotrophic lateral sclerosis     125162001 (BCL2L1)    05022 Pathways of neurodegeneration - multiple diseases     125162001 (BCL2L1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     125162001 (BCL2L1)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     125162001 (BCL2L1)    01524 Platinum drug resistance     125162001 (BCL2L1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:pviv01009]     125162001 (BCL2L1)   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pviv03036]     125162001 (BCL2L1)   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:pviv02000]     125162001 (BCL2L1) Protein phosphatases and associated proteins [BR:pviv01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      125162001 (BCL2L1) Chromosome and associated proteins [BR:pviv03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     125162001 (BCL2L1) Transporters [BR:pviv02000]  Other transporters   Pores ion channels [TC:1]    125162001 (BCL2L1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 Motif Other DBs NCBI-GeneID:  125162001 NCBI-ProteinID:  XP_047708443 LinkDB All DBs Position A3:27086295..27135036 Genome browser AA seq 233 aa AA seqDB search MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLA DSPVVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIATWMATYLNDHLEP WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK NT seq 702 nt NT seq  +upstreamnt  +downstreamnt atgtctcagagcaaccgggagctggtggttgactttctctcctacaagctttcccagaaa ggatacagctggagtcagtttagtgatgtggaagagaacagaactgaggccccagaaggg actgaatcagagatggagacccccagtgccatcaatggcaacccatcctggcacttggcg gacagccctgtggtgaatggagccactggccacagcagcagcttggatgcccgggaggtg atccccatggcagcggtgaagcaggcgctgagggaggccggggatgagtttgaactgagg taccggcgggcattcagcgacctgacatcccagcttcacatcaccccagggacagcatat cagagctttgagcaggtagtgaacgaactcttccgggatggggtgaactggggtcgcatt gtggcctttttctccttcggtggggcactgtgcgtggaaagcgtagacaaggagatgcag gtattggtgagtcggatcgcaacttggatggccacttacctgaacgaccacctagagcct tggatccaggagaacggcggctgggacacttttgtggaactctacgggaacaatgcagcg gccgagagccggaagggccaggagcgcttcaaccgctggttcctgacaggcatgactgtg gctggcgtggttctgctgggctcactcttcagtcggaaatga

DBGET integrated database retrieval system