Prionailurus viverrinus (fishing cat): 125162506 Help Entry 125162506         CDS       T09889                                  Symbol PFN4 Name (RefSeq) profilin-4 isoform X1   KO K05759   profilin Organism pviv  Prionailurus viverrinus (fishing cat) Pathway pviv04015   Rap1 signaling pathway pviv04810   Regulation of actin cytoskeleton pviv05014   Amyotrophic lateral sclerosis pviv05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pviv00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     125162506 (PFN4)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     125162506 (PFN4)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     125162506 (PFN4)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     125162506 (PFN4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pviv04131]     125162506 (PFN4)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:pviv04812]     125162506 (PFN4)    04147 Exosome [BR:pviv04147]     125162506 (PFN4) Membrane trafficking [BR:pviv04131]  Others   Actin-binding proteins    Others     125162506 (PFN4) Cytoskeleton proteins [BR:pviv04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      125162506 (PFN4) Exosome [BR:pviv04147]  Exosomal proteins   Proteins found in most exosomes    125162506 (PFN4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  125162506 NCBI-ProteinID:  XP_047709568 LinkDB All DBs Position A3:122016098..122023581 Genome browser AA seq 129 aa AA seqDB search MSHLQNLLLDTLLGTKHVDSAALIKLQERSLSVASPGFSVMPSDVRTLVNGFAKNPLQTR REGLYFKEKDYKCVRADDYSLYAKNENTGVVVVKTHLYLLVATYTEGMYPSVCVEATEKL GEYLRRKGN NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgagccatttgcagaacttactgttagataccctcctgggaacaaagcatgtggacagt gcagccctcatcaaactccaggagcgaagcttgagtgtagcatcaccaggatttagtgta atgcccagtgatgtccgaactcttgtgaatggattcgccaagaaccctttgcaaaccaga agagaaggactgtatttcaaggaaaaggactacaaatgtgtccgggcagatgactattct ctttatgctaagaatgaaaacactggtgtggttgttgtgaagacccatctgtatcttctg gtggcaacttacactgaaggcatgtatcctagtgtttgtgtggaagccacagagaaactg ggagaatatctaagaagaaaaggaaattaa

DBGET integrated database retrieval system