Prionailurus viverrinus (fishing cat): 125164055 Help Entry 125164055         CDS       T09889                                  Name (RefSeq) thioredoxin   KO K03671   thioredoxin Organism pviv  Prionailurus viverrinus (fishing cat) Pathway pviv04621   NOD-like receptor signaling pathway pviv05012   Parkinson disease pviv05132   Salmonella infection pviv05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pviv00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     125164055  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     125164055   09164 Neurodegenerative disease    05012 Parkinson disease     125164055   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     125164055  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:pviv03110]     125164055 Chaperones and folding catalysts [BR:pviv03110]  Protein folding catalysts   Protein disulfide isomerase    125164055 SSDB OrthologParalogGFIT Motif Pfam:  Thioredoxin Thioredoxin_2 DIM1 Thioredoxin_8 A6-like_Thioredoxin-like_C OST3_OST6 AhpC-TSA Thioredoxin_9 Thioredoxin_7 Glutaredoxin Redoxin PedC-like Motif Other DBs NCBI-GeneID:  125164055 NCBI-ProteinID:  XP_047712451 LinkDB All DBs Position B1:complement(122068976..122069507) Genome browser AA seq 105 aa AA seqDB search MVKQIESKYAFQEALNSAGEKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVVFLEVDVD DCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELI NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggtgaagcagatcgagagcaagtatgcttttcaggaagccttgaacagtgcaggggaa aaacttgtagtagttgatttctctgccacgtggtgtggaccttgcaaaatgatcaagccc ttctttcattccctctctgagaagtattccaacgtggtgttccttgaagtagacgtggat gactgtcaggatgttgcttcagagtgtgaagtcaaatgcatgccaaccttccagtttttt aaaaagggacagaaggtgggtgaattttctggagctaataaggaaaaacttgaagctacc atcaatgaattaatctaa

DBGET integrated database retrieval system