Prionailurus viverrinus (fishing cat): 125165434 Help Entry 125165434         CDS       T09889                                  Symbol CSNK2B Name (RefSeq) casein kinase II subunit beta   KO K03115   casein kinase II subunit beta Organism pviv  Prionailurus viverrinus (fishing cat) Pathway pviv03008   Ribosome biogenesis in eukaryotes pviv03083   Polycomb repressive complex pviv04064   NF-kappa B signaling pathway pviv04137   Mitophagy - animal pviv04310   Wnt signaling pathway pviv04520   Adherens junction pviv05010   Alzheimer disease pviv05020   Prion disease pviv05022   Pathways of neurodegeneration - multiple diseases pviv05162   Measles pviv05235   PD-L1 expression and PD-1 checkpoint pathway in cancer Brite KEGG Orthology (KO) [BR:pviv00001]  09120 Genetic Information Processing   09122 Translation    03008 Ribosome biogenesis in eukaryotes     125165434 (CSNK2B)   09126 Chromosome    03083 Polycomb repressive complex     125165434 (CSNK2B)  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     125165434 (CSNK2B)    04064 NF-kappa B signaling pathway     125165434 (CSNK2B)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     125165434 (CSNK2B)   09144 Cellular community - eukaryotes    04520 Adherens junction     125165434 (CSNK2B)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     125165434 (CSNK2B)   09172 Infectious disease: viral    05162 Measles     125165434 (CSNK2B)   09164 Neurodegenerative disease    05010 Alzheimer disease     125165434 (CSNK2B)    05020 Prion disease     125165434 (CSNK2B)    05022 Pathways of neurodegeneration - multiple diseases     125165434 (CSNK2B)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03009 Ribosome biogenesis [BR:pviv03009]     125165434 (CSNK2B)    03036 Chromosome and associated proteins [BR:pviv03036]     125165434 (CSNK2B) Ribosome biogenesis [BR:pviv03009]  Eukaryotic type   90S particles    Kinase     125165434 (CSNK2B) Chromosome and associated proteins [BR:pviv03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.3/1.5)      125165434 (CSNK2B) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CK_II_beta Motif Other DBs NCBI-GeneID:  125165434 NCBI-ProteinID:  XP_047714290 LinkDB All DBs Position B2:30343818..30347916 Genome browser AA seq 215 aa AA seqDB search MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDE ELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPML PIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPA NQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atgagcagctcagaggaggtgtcctggatttcctggttctgtgggctccgtggcaatgaa ttcttctgtgaagtggatgaagactacatccaggacaaattcaacctcactggactcaat gagcaggtgccccactatcgacaagctctagacatgatcttggacctggagcctgatgaa gagctggaagacaaccccaaccagagtgacctgattgagcaggcagccgagatgctttat ggattgatccacgcccgctatatcctcaccaaccgtggcatcgcccagatgttggaaaag taccagcaaggagactttggctactgtccccgtgtgtactgtgagaatcagccaatgctt cccatcggcctttcggacatcccaggtgaggccatggtgaagctctactgccccaagtgc atggacgtgtacacacccaagtcatcgaggcaccatcacacggacggcgcctacttcggc accggtttccctcacatgctcttcatggtgcaccctgagtaccggcccaaacggcccgcc aaccagtttgtgcccaggctctacggtttcaagatccatccaatggcctaccagctgcag ctccaagccgccagcaacttcaagagcccagtcaagacgattcgctga

DBGET integrated database retrieval system