Prionailurus viverrinus (fishing cat): 125166588 Help Entry 125166588         CDS       T09889                                  Name (RefSeq) histone H3.1   KO K11253   histone H3 Organism pviv  Prionailurus viverrinus (fishing cat) Pathway pviv04613   Neutrophil extracellular trap formation pviv05034   Alcoholism pviv05202   Transcriptional misregulation in cancer pviv05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:pviv00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     125166588  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     125166588   09163 Immune disease    05322 Systemic lupus erythematosus     125166588   09165 Substance dependence    05034 Alcoholism     125166588  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pviv03036]     125166588   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pviv04147]     125166588 Chromosome and associated proteins [BR:pviv03036]  Eukaryotic type   Nucleosome assembly factors    Histones     125166588 Exosome [BR:pviv04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    125166588 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-S CENP-T_C CBFD_NFYB_HMF PAF YebU_pre-PUA_dom TFIID-31kDa Motif Other DBs NCBI-GeneID:  125166588 NCBI-ProteinID:  XP_047716464 LinkDB All DBs Position B2:complement(3487373..3517264) Genome browser AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgcacgaagcagacggcgcgcaagtcgacgggcggcaaggccccgcgcaagcag ctggccaccaaggcggcccgcaagagcgcgccggccaccggcggcgtcaagaagccgcac cgctaccggcccggcacggtggccctgcgcgagatccgccgctaccagaagtccaccgag ctgctgatccgcaagctgccgttccagcggctggtgcgcgagatcgcgcaggacttcaag accgacctgcgcttccagagctcggccgtgatggcgctgcaggaggcgtgcgaggcctac ctggtggggctcttcgaggacaccaacctgtgcgccatccacgccaagcgcgtcaccatc atgcccaaggacatccagctggcgcgccgcatccgcggggagcgggcgtaa

DBGET integrated database retrieval system